KEGG   Felis catus (domestic cat): 101090321Help
Entry
101090321         CDS       T02385                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
fca  Felis catus (domestic cat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101090321 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101090321 (LAMC1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101090321 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101090321 (LAMC1)
   05222 Small cell lung cancer
    101090321 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    101090321 (LAMC1)
  Infectious diseases
   05146 Amoebiasis
    101090321 (LAMC1)
   05145 Toxoplasmosis
    101090321 (LAMC1)
Cell adhesion molecules and their ligands [BR:fca04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      101090321 (LAMC1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      101090321 (LAMC1)
     Laminin-2 Extracellular matrix (ECM) components
      101090321 (LAMC1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      101090321 (LAMC1)
   VLA-3
      101090321 (LAMC1)
     Laminin-10 Extracellular matrix (ECM) components
      101090321 (LAMC1)
     Laminin-11 Extracellular matrix (ECM) components
      101090321 (LAMC1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      101090321 (LAMC1)
     Laminin-8 Extracellular matrix (ECM) components
      101090321 (LAMC1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      101090321 (LAMC1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      101090321 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
F1
AA seq 1515 aa AA seqDB search
MALDQQQQTAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLKFHT
SRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFSDISP
LTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYY
YAISDFAVGGRCKCNGHASECVKNEFNKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAE
SASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQGNTDGAKCERCRENFFRLGNNEA
CSPCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGYHSLTEAGCRPCSCNPSGSID
ECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYS
ITSTFQIDEDGWHVEQRDGSEASLEWSSERQDVAVISDSYFPRYFIAPAKFLGKQLLSYG
QNLTFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYP
WRPPLTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLTSARPGPGVPATWVESCTCPV
GYGGQFCEMCLSGYRRETPSLGPYSPCVLCTCNGHSETCDPETGVCNCRDNTAGPHCEKC
GDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTQEVVCTNCPTGTTGKRCELCDDGYFGD
PLGRNGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNALA
PNPADKCKACDCHPYGTVKQQRGCNPVTGQCECLPHVTGRDCGACDPGFYNLQSGQGCER
CDCHALGSTNGQCDIRSGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQ
CKDDGRCECREGFVGNRCDQCEENYFYNRSRPGCQECPACYRLVKDKVADHRMKLQELEN
LIANLGTGEEVVTDQAFEDRLKEAEREVMDLLREAQDVKDIDQNLIDRLQRLNNTLSSQI
SRLQNIRNTIEETGNLAEQARARVESTEQLIEIASRELEKAKIAVANVSITQPESTGDPN
NMTLLAEEARKLAERHKQEADDIVRVAKTANETSTEAYDLLLRTLAGENQTTLEIEELNR
KYEQAKNISQDLEKQAARVHEEAKRAGDKAVEIYASVAQLTPVDSEALENEANKIKKEAE
DLDHLIDQKLKDYEDLREDMRGKELEVKKLLEKGKIEQQTADQLLARADAAKAVAEEAAK
KGRNTLQEANDILSNLRDFDRRVNDNKTAAEEALRRIPAINQTIIEANEKTREAQLALGN
AAADATEAKSKAHEAERIASAVQRNATSTKAEAEKTFAEVTDLDNEVNDMLKQLQEAEKE
LKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLNLINDLLEQLGQLDTVDLNK
LNEIEGTLNKAKDEMKVSDLDRKVSDLENEARKQEAAIMDYNRDIEEIMKDIRNLEDIKK
TLPSGCFNTPSIEKP
NT seq 4548 nt NT seq  +upstreamnt  +downstreamnt
atggcactggatcaacagcaacaaacagccttcctgaccgactacaacaaccaggccgac
accacctggtggcaaagccagaccatgctggccggggtgcagtaccccaactccatcaac
ctcacgctgcacctgggaaaagcttttgacatcacatacgtgcgcctcaagttccacacc
agccgcccggagagcttcgccatttacaagcgtacacgggaagatgggccctggattcct
taccagtattacagcggctcctgcgagaacacctactcgaaggcaaaccgcggcttcatc
aggacaggaggagatgagcagcaggccttgtgcacagatgaattcagtgatatttcccct
ctgactggaggcaatgtggccttttcaaccctagaaggaaggccgagtgcctacaacttc
gacaatagtccggtgctgcaggaatgggtaactgccactgacatcagagtcacactcaat
cgcctgaacacctttggagatgaagtgtttaacgatcccaaagttctcaagtcctactat
tatgcaatctctgattttgctgtgggtggtaggtgtaaatgtaacggacatgcaagcgag
tgtgtaaagaacgaattcaacaagctggtgtgtaattgtaaacataacacttacggagtg
gactgtgaaaagtgtctgcctttcttcaatgaccggccgtggaggagggcgaccgccgag
agtgccagcgaatgcctgccctgtgactgcaatggccgatcacaagaatgctactttgac
cctgaactataccggtccaccggccatggtggccattgcaccaactgccagggcaacacg
gatggtgccaaatgtgagaggtgccgggagaatttcttccgccttgggaacaacgaagcc
tgctctccgtgtcactgtagtcctgtgggttctctcagcacacagtgtgatagctatggc
aggtgtagctgtaagccaggagtgatgggtgataagtgtgaccgctgccagcctggatac
cattctctcactgaggcaggatgcaggccatgctcttgtaatccttctggcagcatagat
gaatgtaatgttgaaacaggaagatgtgtttgcaaagacaatgttgaaggcttcaattgt
gagaggtgcaaacctggattttttaatctggaatcatctaatcccagaggttgcacaccc
tgcttctgctttgggcattcttctgtctgtacaaatgctgtcggctacagtgtttattct
ataacctctacctttcagatcgatgaggatgggtggcatgtagaacaaagggatggctct
gaagcatcactcgagtggtcctcagagaggcaggatgtcgccgtcatctcagatagctac
tttcctagatacttcattgctcctgcgaagttcctgggcaagcagttgttgagttatggc
cagaacctcaccttctcctttcgagtggacaggcgagacactcgcctgtctgcagaagac
ctggtgcttgaaggagctggcctgagagtgtctgtgcccttgatcgctcagggcaattcc
tatccaagtgagaccactgtgaaatacgtcttcaggctccatgaagcaacagattatcct
tggaggcctcctcttacaccttttgaatttcagaagctcctaaacaatttgacctccatc
aagatccgtgggacatacagtgagagaagtgctggctatttggatgatgtcaccctgaca
agcgctcgccccgggcctggggtgcctgcaacgtgggtggagtcttgtacctgtcctgtg
ggatacggagggcagttttgtgagatgtgcctctcaggttacagaagagaaactccgagt
ctcgggccatacagcccgtgtgtgctctgtacctgcaatggacacagtgagacctgtgac
cctgagacaggtgtttgcaactgcagagacaatacagctggaccccactgtgagaagtgc
ggtgacgggtactatggagattcgaccgcgggcacctcttccgattgccagccctgtccg
tgtcctgggggctcgagttgtgccgttgtccctaagactcaggaggtggtgtgcaccaac
tgtcccactggcaccactggtaaaagatgtgagctctgtgacgatggctactttggagac
cctctggggagaaacggccccgtgaggctttgccgcctctgccagtgcaatgacaacatc
gatcccaatgccgttggaaattgcaatcgcttgacaggagaatgcctgaaatgcatctat
aacactgctggcttctattgtgaccgatgcaaagatggattttttggaaatgccctggcc
cccaatccagcagacaaatgcaaagcctgtgactgccatccctatggaaccgtgaagcag
cagagaggctgtaaccctgtgaccgggcagtgcgaatgtctgccccacgtgactggccgg
gactgtggggcctgtgaccccggcttctacaacctgcagagtgggcaaggctgcgagagg
tgtgactgccatgctttgggttccaccaatggacagtgtgacatccgcagtggccagtgt
gagtgccagcctggcatcaccggtcagcactgcgagcgctgtgaggtcaaccacttcggg
tttggacccgaaggctgcaaaccgtgtgactgtcatcccgagggatctctttcactccag
tgcaaagacgatggtcgctgtgaatgcagagaaggttttgtgggaaatcgctgtgaccag
tgtgaagagaactatttctacaatcggtctcggcctggctgccaggaatgtccagcatgt
taccggctggtgaaggataaggttgctgatcatcgaatgaaactccaggaattagagaat
ctcatagcaaaccttggaactggggaagaggtggtgacagatcaagcctttgaggacagg
ctaaaggaagcagagagagaagttatggacctccttcgagaggcccaggatgtcaaagat
atagaccagaatttgatagatcgcctccagagattgaataataccttatccagccaaatt
agccgtttacagaatatacggaataccattgaagagactggaaacttggctgagcaagca
cgtgccagggtagaaagcactgagcagttgattgaaattgcatcccgagaacttgagaaa
gcaaagattgctgttgccaatgtgtcaatcactcaaccagagtccaccggggacccaaac
aacatgactcttttggctgaagaggcacgaaagcttgctgaacgccataaacaagaagct
gatgatattgtaagagtggcaaagacagctaatgagacatcaactgaggcatatgatctg
cttctgagaacactggcaggagagaatcaaacaacactggagattgaggagcttaataga
aagtatgaacaagcaaagaacatctcacaggatctggagaagcaagctgcccgagtgcat
gaagaggccaaaagggctggagataaagcggtggagatctatgccagcgttgcccagctg
acgcctgtggactcagaagcactggagaatgaggcaaataaaataaagaaggaagctgag
gatctggaccatctgattgaccagaagttaaaagattatgaggacctcagagaggacatg
agagggaaggaactggaagtcaagaagcttctggaaaagggaaagattgaacagcagact
gctgaccagctcctagcccgagcagatgccgccaaggctgttgccgaagaagctgctaaa
aagggacgaaataccttacaagaagccaacgacatcctcagcaacctgagagattttgac
aggcgtgtgaacgataacaagacagctgcagaggaggctctaaggagaattcctgccatc
aaccagaccataattgaagccaatgaaaagacgagggaggcacagctggccctgggcaat
gccgctgcggatgccaccgaagccaagagcaaggcccacgaggccgagaggatcgccagt
gctgtccaaaggaatgctaccagcaccaaggcagaagctgaaaagacatttgcagaagtt
acagacctggataacgaggtgaacgatatgttgaaacaactacaggaagcagaaaaggag
ctgaagagaaaacaagatgatgctgaccaggatatgatgatggcagggatggcttcacag
gctgctcaggaagccgagatcaatgccagaaaagccaaaaactccgtcaccagcctcctc
aacctgattaatgacctcttggagcagctggggcagctggacacagtggacctgaacaag
ctgaatgagattgaaggtaccctgaacaaagccaaagatgagatgaaagtcagcgatcta
gacaggaaagtatctgacctggagaatgaagcgaggaagcaggaggctgccatcatggac
tataacagagatatcgaggagatcatgaaggacattcgcaacctggaagacatcaagaag
accctaccgtctggctgcttcaacaccccgtccattgaaaagccctag

DBGET integrated database retrieval system