KEGG   Felis catus (domestic cat): 101090321Help
Entry
101090321         CDS       T02385                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
fca  Felis catus (domestic cat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:fca04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:fca04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:fca04510]
Human Diseases; Cancers; Pathways in cancer [PATH:fca05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:fca05222]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:fca05020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:fca05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:fca05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
F1
AA seq 1515 aa AA seqDB search
MALDQQQQTAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLKFHT
SRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFSDISP
LTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYY
YAISDFAVGGRCKCNGHASECVKNEFNKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAE
SASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQGNTDGAKCERCRENFFRLGNNEA
CSPCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGYHSLTEAGCRPCSCNPSGSID
ECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYS
ITSTFQIDEDGWHVEQRDGSEASLEWSSERQDVAVISDSYFPRYFIAPAKFLGKQLLSYG
QNLTFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYP
WRPPLTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLTSARPGPGVPATWVESCTCPV
GYGGQFCEMCLSGYRRETPSLGPYSPCVLCTCNGHSETCDPETGVCNCRDNTAGPHCEKC
GDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTQEVVCTNCPTGTTGKRCELCDDGYFGD
PLGRNGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNALA
PNPADKCKACDCHPYGTVKQQRGCNPVTGQCECLPHVTGRDCGACDPGFYNLQSGQGCER
CDCHALGSTNGQCDIRSGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQ
CKDDGRCECREGFVGNRCDQCEENYFYNRSRPGCQECPACYRLVKDKVADHRMKLQELEN
LIANLGTGEEVVTDQAFEDRLKEAEREVMDLLREAQDVKDIDQNLIDRLQRLNNTLSSQI
SRLQNIRNTIEETGNLAEQARARVESTEQLIEIASRELEKAKIAVANVSITQPESTGDPN
NMTLLAEEARKLAERHKQEADDIVRVAKTANETSTEAYDLLLRTLAGENQTTLEIEELNR
KYEQAKNISQDLEKQAARVHEEAKRAGDKAVEIYASVAQLTPVDSEALENEANKIKKEAE
DLDHLIDQKLKDYEDLREDMRGKELEVKKLLEKGKIEQQTADQLLARADAAKAVAEEAAK
KGRNTLQEANDILSNLRDFDRRVNDNKTAAEEALRRIPAINQTIIEANEKTREAQLALGN
AAADATEAKSKAHEAERIASAVQRNATSTKAEAEKTFAEVTDLDNEVNDMLKQLQEAEKE
LKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLNLINDLLEQLGQLDTVDLNK
LNEIEGTLNKAKDEMKVSDLDRKVSDLENEARKQEAAIMDYNRDIEEIMKDIRNLEDIKK
TLPSGCFNTPSIEKP
NT seq 4548 nt NT seq  +upstreamnt  +downstreamnt
atggcactggatcaacagcaacaaacagccttcctgaccgactacaacaaccaggccgac
accacctggtggcaaagccagaccatgctggccggggtgcagtaccccaactccatcaac
ctcacgctgcacctgggaaaagcttttgacatcacatacgtgcgcctcaagttccacacc
agccgcccggagagcttcgccatttacaagcgtacacgggaagatgggccctggattcct
taccagtattacagcggctcctgcgagaacacctactcgaaggcaaaccgcggcttcatc
aggacaggaggagatgagcagcaggccttgtgcacagatgaattcagtgatatttcccct
ctgactggaggcaatgtggccttttcaaccctagaaggaaggccgagtgcctacaacttc
gacaatagtccggtgctgcaggaatgggtaactgccactgacatcagagtcacactcaat
cgcctgaacacctttggagatgaagtgtttaacgatcccaaagttctcaagtcctactat
tatgcaatctctgattttgctgtgggtggtaggtgtaaatgtaacggacatgcaagcgag
tgtgtaaagaacgaattcaacaagctggtgtgtaattgtaaacataacacttacggagtg
gactgtgaaaagtgtctgcctttcttcaatgaccggccgtggaggagggcgaccgccgag
agtgccagcgaatgcctgccctgtgactgcaatggccgatcacaagaatgctactttgac
cctgaactataccggtccaccggccatggtggccattgcaccaactgccagggcaacacg
gatggtgccaaatgtgagaggtgccgggagaatttcttccgccttgggaacaacgaagcc
tgctctccgtgtcactgtagtcctgtgggttctctcagcacacagtgtgatagctatggc
aggtgtagctgtaagccaggagtgatgggtgataagtgtgaccgctgccagcctggatac
cattctctcactgaggcaggatgcaggccatgctcttgtaatccttctggcagcatagat
gaatgtaatgttgaaacaggaagatgtgtttgcaaagacaatgttgaaggcttcaattgt
gagaggtgcaaacctggattttttaatctggaatcatctaatcccagaggttgcacaccc
tgcttctgctttgggcattcttctgtctgtacaaatgctgtcggctacagtgtttattct
ataacctctacctttcagatcgatgaggatgggtggcatgtagaacaaagggatggctct
gaagcatcactcgagtggtcctcagagaggcaggatgtcgccgtcatctcagatagctac
tttcctagatacttcattgctcctgcgaagttcctgggcaagcagttgttgagttatggc
cagaacctcaccttctcctttcgagtggacaggcgagacactcgcctgtctgcagaagac
ctggtgcttgaaggagctggcctgagagtgtctgtgcccttgatcgctcagggcaattcc
tatccaagtgagaccactgtgaaatacgtcttcaggctccatgaagcaacagattatcct
tggaggcctcctcttacaccttttgaatttcagaagctcctaaacaatttgacctccatc
aagatccgtgggacatacagtgagagaagtgctggctatttggatgatgtcaccctgaca
agcgctcgccccgggcctggggtgcctgcaacgtgggtggagtcttgtacctgtcctgtg
ggatacggagggcagttttgtgagatgtgcctctcaggttacagaagagaaactccgagt
ctcgggccatacagcccgtgtgtgctctgtacctgcaatggacacagtgagacctgtgac
cctgagacaggtgtttgcaactgcagagacaatacagctggaccccactgtgagaagtgc
ggtgacgggtactatggagattcgaccgcgggcacctcttccgattgccagccctgtccg
tgtcctgggggctcgagttgtgccgttgtccctaagactcaggaggtggtgtgcaccaac
tgtcccactggcaccactggtaaaagatgtgagctctgtgacgatggctactttggagac
cctctggggagaaacggccccgtgaggctttgccgcctctgccagtgcaatgacaacatc
gatcccaatgccgttggaaattgcaatcgcttgacaggagaatgcctgaaatgcatctat
aacactgctggcttctattgtgaccgatgcaaagatggattttttggaaatgccctggcc
cccaatccagcagacaaatgcaaagcctgtgactgccatccctatggaaccgtgaagcag
cagagaggctgtaaccctgtgaccgggcagtgcgaatgtctgccccacgtgactggccgg
gactgtggggcctgtgaccccggcttctacaacctgcagagtgggcaaggctgcgagagg
tgtgactgccatgctttgggttccaccaatggacagtgtgacatccgcagtggccagtgt
gagtgccagcctggcatcaccggtcagcactgcgagcgctgtgaggtcaaccacttcggg
tttggacccgaaggctgcaaaccgtgtgactgtcatcccgagggatctctttcactccag
tgcaaagacgatggtcgctgtgaatgcagagaaggttttgtgggaaatcgctgtgaccag
tgtgaagagaactatttctacaatcggtctcggcctggctgccaggaatgtccagcatgt
taccggctggtgaaggataaggttgctgatcatcgaatgaaactccaggaattagagaat
ctcatagcaaaccttggaactggggaagaggtggtgacagatcaagcctttgaggacagg
ctaaaggaagcagagagagaagttatggacctccttcgagaggcccaggatgtcaaagat
atagaccagaatttgatagatcgcctccagagattgaataataccttatccagccaaatt
agccgtttacagaatatacggaataccattgaagagactggaaacttggctgagcaagca
cgtgccagggtagaaagcactgagcagttgattgaaattgcatcccgagaacttgagaaa
gcaaagattgctgttgccaatgtgtcaatcactcaaccagagtccaccggggacccaaac
aacatgactcttttggctgaagaggcacgaaagcttgctgaacgccataaacaagaagct
gatgatattgtaagagtggcaaagacagctaatgagacatcaactgaggcatatgatctg
cttctgagaacactggcaggagagaatcaaacaacactggagattgaggagcttaataga
aagtatgaacaagcaaagaacatctcacaggatctggagaagcaagctgcccgagtgcat
gaagaggccaaaagggctggagataaagcggtggagatctatgccagcgttgcccagctg
acgcctgtggactcagaagcactggagaatgaggcaaataaaataaagaaggaagctgag
gatctggaccatctgattgaccagaagttaaaagattatgaggacctcagagaggacatg
agagggaaggaactggaagtcaagaagcttctggaaaagggaaagattgaacagcagact
gctgaccagctcctagcccgagcagatgccgccaaggctgttgccgaagaagctgctaaa
aagggacgaaataccttacaagaagccaacgacatcctcagcaacctgagagattttgac
aggcgtgtgaacgataacaagacagctgcagaggaggctctaaggagaattcctgccatc
aaccagaccataattgaagccaatgaaaagacgagggaggcacagctggccctgggcaat
gccgctgcggatgccaccgaagccaagagcaaggcccacgaggccgagaggatcgccagt
gctgtccaaaggaatgctaccagcaccaaggcagaagctgaaaagacatttgcagaagtt
acagacctggataacgaggtgaacgatatgttgaaacaactacaggaagcagaaaaggag
ctgaagagaaaacaagatgatgctgaccaggatatgatgatggcagggatggcttcacag
gctgctcaggaagccgagatcaatgccagaaaagccaaaaactccgtcaccagcctcctc
aacctgattaatgacctcttggagcagctggggcagctggacacagtggacctgaacaag
ctgaatgagattgaaggtaccctgaacaaagccaaagatgagatgaaagtcagcgatcta
gacaggaaagtatctgacctggagaatgaagcgaggaagcaggaggctgccatcatggac
tataacagagatatcgaggagatcatgaaggacattcgcaacctggaagacatcaagaag
accctaccgtctggctgcttcaacaccccgtccattgaaaagccctag

DBGET integrated database retrieval system