KEGG   Felis catus (domestic cat): 101090326Help
Entry
101090326         CDS       T02385                                 

Gene name
PPOX
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
fca  Felis catus (domestic cat)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101090326 (PPOX)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101090326 (PPOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
F1
AA seq 477 aa AA seqDB search
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVEASERLGGWIRSVRGPGGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAKNRFLYVGGALHALPSGLRGLFRPSP
PFSKPLFWAGLRELTAPRGKDPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSV
RSCFPSLFQAEQTHRSVLLGLLLGAGQSPQPDSALISQARAERWSQWSLRGGLETLPQAL
NTHLTSRGVRILRGQPVCGLSLQADRRWKVSLGDSSLDADHVISAVPASVLGKLLPAEAA
PLARALSAITAVSVAVVNLQYRGARLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEARGAVLSPELLQQQAQEAAATQLGLKEPPSHCLVHLHKNCIP
QYTLGHWQKLEAATQFLASQRLPLTLAGASYEGVAVNDCIESGRQAAARVLGSEPDS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaccgtggtcgtgctgggaggaggcatcagcggcttggccgccagttaccac
ctgagccgggccccctgtccccccaaggtggtcctggtggaggccagcgagcgtctggga
ggctggatccgctcagtccgagggccaggtggtgctatctttgaacttggacctcgagga
attcggccggcgggagccctgggggcccggaccctgctcctggtttctgagcttggcttg
gactcagaagtgttgcctgtccggggagaccacccagctgccaagaacaggttcctgtat
gtaggtggcgccctgcatgcgctgccctccggcctcagggggctcttccgcccttcaccg
cccttctccaaacctctgttttgggctgggctgagggagttgaccgcgcccaggggcaaa
gaccctgatgagactgtgcacagttttgcccagcgccgccttggacccgaggtggcgtct
ctagccatggacagcctctgccgaggagtgtttgcaggcaacagccgagagctcagcgtc
aggtcctgctttcccagtctcttccaagccgagcaaacccatcgttccgttttactgggg
ctgctgctgggagcagggcagagcccgcagccagactccgcactcattagccaggcccga
gccgagcgctggagccagtggtccctccgaggagggctggaaacgttgccccaagccctt
aacacccacctgactagtagaggagtccgtattctcagaggccagcccgtctgtgggctc
agcctccaggcagacaggcgctggaaggtgtctctaggggacagcagtctggatgctgac
cacgttattagtgctgttccagcttcagtgctcggcaagctgctccctgcggaggctgcg
cctctggcccgggccctgagcgccatcactgcggtgtctgtggctgtggtgaacctgcag
taccgaggagcccgtctgcccgtgcagggattcggacatttggtgccatcctcagaagac
ccgggcgtcctgggaattgtgtatgactcggttgctttccctgagcaggacggaagcccc
cccggcctccgagtgactgtgatgctgggagggtcctggttacagacgctggaagccagg
ggcgccgtcttatctccggagctgctccaacaacaggcccaggaagcagctgccacccag
ctaggactgaaagagccacccagccactgcttggtccatctacacaagaactgcatcccc
cagtatacactaggccactggcaaaaactggaggcagctacgcaattcttggcttctcag
aggctgcccttgactctggccggagcctcctatgagggggttgccgtcaacgactgtata
gagagcggacgccaggcagcagcccgggtcctgggctcggaaccggacagctga

DBGET integrated database retrieval system