KEGG   Felis catus (domestic cat): 101090344Help
Entry
101090344         CDS       T02385                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04720  Long-term potentiation
fca04724  Glutamatergic synapse
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca05010  Alzheimer's disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05031  Amphetamine addiction
fca05152  Tuberculosis
fca05166  HTLV-I infection
fca05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101090344 (PPP3R1)
   04310 Wnt signaling pathway
    101090344 (PPP3R1)
   04370 VEGF signaling pathway
    101090344 (PPP3R1)
   04020 Calcium signaling pathway
    101090344 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    101090344 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101090344 (PPP3R1)
   04218 Cellular senescence
    101090344 (PPP3R1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    101090344 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    101090344 (PPP3R1)
   04660 T cell receptor signaling pathway
    101090344 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    101090344 (PPP3R1)
   04659 Th17 cell differentiation
    101090344 (PPP3R1)
   04662 B cell receptor signaling pathway
    101090344 (PPP3R1)
  Endocrine system
   04922 Glucagon signaling pathway
    101090344 (PPP3R1)
   04921 Oxytocin signaling pathway
    101090344 (PPP3R1)
   04924 Renin secretion
    101090344 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    101090344 (PPP3R1)
   04720 Long-term potentiation
    101090344 (PPP3R1)
  Development
   04360 Axon guidance
    101090344 (PPP3R1)
   04380 Osteoclast differentiation
    101090344 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101090344 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    101090344 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    101090344 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    101090344 (PPP3R1)
   05166 HTLV-I infection
    101090344 (PPP3R1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101090344 (PPP3R1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101090344 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 101090344
NCBI-ProteinID: XP_019682866
Ensembl: ENSFCAG00000028482
Position
A3
AA seq 164 aa AA seqDB search
MAGAGKQKVDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDG
NGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKD
TQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggcaggcaaacaaaaagttgatgctgatgaaattaaaaggctaggaaagaga
tttaagaagctcgatttggacaattctggttctttgagtgtggaagagttcatgtctctg
cctgagttacaacagaatcctttagtacagcgagtaatagatatatttgacacagatggg
aatggagaagtagactttaaagaattcattgagggagtctctcagttcagtgtcaaagga
gataaggaacagaagttgaggtttgctttccgtatctatgacatggataaagatggctat
atttccaacggggaactcttccaggtgctgaagatgatggtggggaacaatctgaaagat
acacagttacagcaaattgtagacaaaaccataataaatgcagataaggatggagatgga
agaatatcctttgaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatg
gtggtagatgtgtga

DBGET integrated database retrieval system