KEGG   Felis catus (domestic cat): 101090367Help
Entry
101090367         CDS       T02385                                 

Gene name
LYZL1
Definition
lysozyme-like 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B4
AA seq 148 aa AA seqDB search
MKAASILALIGCLVTVTESKVYTRCKLAKIFSRAGLDNYQGFSLGNWICMAYYESHYNTT
AQTQLEDGSTDYGIFQINSFTWCRHAKLQEKNHCHVACSALLTDDLTDAIICAKKIAKET
EGMNYWQGWKKHCEGKDLSEWKKGCEVS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgccagcatcttggccctgattggctgcctggtcaccgtcactgagtccaaa
gtctacactcgctgtaaactggcaaaaatattttcaagggctggcctggacaattaccag
ggttttagccttggaaactggatctgcatggcatactatgagagccactacaatacgaca
gcgcagacccagctggaggatggaagcactgactatggcattttccagataaacagcttc
acgtggtgcagacatgctaagctacaggagaagaaccactgtcacgtcgcctgctcagcc
ttgctcactgacgacctcacagatgcgattatctgtgccaagaaaattgctaaagagaca
gaagggatgaactattggcaaggctggaagaaacactgcgagggcaaggacctgtctgaa
tggaaaaagggatgtgaggtctcctga

DBGET integrated database retrieval system