KEGG   Felis catus (domestic cat): 101090455Help
Entry
101090455         CDS       T02385                                 

Gene name
PLCD4
Definition
phospholipase C, delta 4
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101090455 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101090455 (PLCD4)
   04070 Phosphatidylinositol signaling system
    101090455 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101090455 (PLCD4)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101090455 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 826 aa AA seqDB search
MVSLMQGRLPINQDVLLMQKGMLVRKVRSKSWKKLRYFRLQDDGMTVWHARQAGGKAKPS
FSISDVETVREGHESELLRSLAEEFPLEQGFTIVFHGRRSNLDLVANSVEEAQIWMQGLQ
HLVDFVTSMDQKERLDQWLSDWFQRGDKNQDGRMSFPEVQRLLHLMNVEMDQEYALQLFQ
AADTSQSGTLEGEEFVEFYKALTKRPEVQEVFENFSADGQKLTLLEFVDFLREEQKEGER
ASDLALELIDRYEPSDSGKVRHVLSLDGFLSYLCSKDGDVFNPACLPIYQDMTQPLNHYY
INSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDIWDGPSGEPIVYHGHTLTSRIPF
KDVVATVAQYAFQTSDYPVILSLENHCTWEQQQVMALHLTEILGEQLLSTTLDGLLPTQL
PSPEELRRKILVKGKKLQTLEEDLEEEEEEEVLESQLEGEQEARPELEAQFESEPQELSP
RSKDKKKDKVVMCPPFCTPICCQIMVQAPSSKPESLLFPKQKSKPIMCPSLSALVVYLKA
VSFHSFTHSREHYRFYETSSFSETKAKSLIKEAGNAFVQHNAWQLSRVYPSGLRTDSSNY
NPQELWNAGCQMVAMNVQTAGLEMDICDGLFRQNGGCGYVLKPDFLRDIQSSFHPERPIS
PFKAQTLLIQVISGQQLPKEDMTKERSIVDPLVRVEIFGVRPDTTRQETSYVENNGFNPY
WGQTLCFRVLVPELALLRFVVNDYNWKTRHDFIGQYTLPWTCMQQGGPVPQTLASGPAPA
PFLMLSSCPFPGYRHIHLLSKDGTSLHPASIFVHICIREGLEGDES
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccttgatgcaaggccggctgcccatcaatcaagatgtgctgctgatgcagaaa
ggcatgctggtgcgcaaggtgaggtccaaaagctggaagaaactaagatacttcagactt
caggatgatggcatgacagtctggcatgcccggcaggcaggaggcaaggccaagcccagc
ttctcaatctctgatgtggagacagtgcgtgagggccatgagtctgagctgttgcgcagc
ctggcagaggagttccccctggagcagggcttcaccatcgtcttccatggccgccgttcc
aacctggacctggtggccaacagcgttgaggaggcccagatatggatgcaggggctccaa
catttggtggactttgtcaccagcatggaccaaaaggagcggctggaccagtggctgagt
gactggttccagcgtggagacaagaaccaggatggtcgcatgagtttcccagaggtccag
cggttactacacctgatgaatgtggaaatggaccaggaatatgccttgcagcttttccaa
gcagcagacacatcccagtctgggactctggaaggagaagaatttgtagagttctataag
gcgttgactaagcgccctgaggtacaggaagtgtttgaaaacttttcagctgatgggcag
aagctgaccctgctggaatttgtggatttcctccgagaggagcagaaagaaggagaaaga
gcttcagaccttgctctggaactcatcgaccgctatgagccttcagatagcggcaaagtg
cgacatgtgctgagcttggatggcttcctcagctacctctgctcgaaggatggagatgtc
ttcaacccagcctgcctccccatctaccaggatatgactcaacccctgaaccactattat
atcaactcctctcacaacacctacctagtgggggaccagctttgtggccagagcagcgtc
gaaggatatatacgggccctgaagagggggtgccgctgtgtggaggtggatatatgggac
ggacctagtggggagcctatcgtttaccatggacacaccctgacctcccgcatcccgttc
aaagatgtcgtggccactgtagcacagtacgccttccagacatcagactacccagtcatc
ttgtccctggagaaccactgcacctgggagcagcagcaggtcatggcgcttcatctgacc
gagatcttgggggagcaattgctgagcacaaccttggacgggctgctgcccactcagctg
ccctcgcctgaggagcttcggaggaagatcctggtgaaggggaagaagctacagaccctt
gaggaggacctcgaggaagaggaagaggaggaagtgctggagtctcaactggagggagag
caggaggctaggccagagctggaggcccagtttgagtctgagccccaggagctgagcccc
cgcagtaaggacaaaaagaaggacaaggttgtgatgtgtccgccgttttgtacgcctatc
tgttgtcagattatggttcaggctcctagttccaagcctgagtcccttctctttcccaag
cagaaatccaaacccatcatgtgtccatccctctctgccctggttgtctacttgaaggcc
gtctcattccacagcttcactcactcgagggagcactaccgcttctatgaaacatcatct
ttctctgaaaccaaggccaagagcctcatcaaagaggctggcaatgcgtttgtgcagcac
aacgcctggcagttaagccgtgtgtatcccagtggcctgaggacagattcgtccaactac
aacccccaggaactctggaatgcgggttgccagatggtggctatgaatgtgcagactgcg
gggctggagatggacatctgtgatgggctcttccgccagaacggtggctgtggctatgtg
ctgaagccagacttcctgcgtgacatccagagttccttccacccagagaggcccatcagc
cctttcaaagcccagaccctcctaatccaggtgatcagtggtcagcaactccccaaggag
gacatgactaaagagaggtccattgtggatccactggtgagagttgaaatcttcggtgtc
cgcccagacacaacccggcaagagacgagctacgtggagaacaatggttttaatccatac
tgggggcagacactatgcttccgggtcctggtgcctgaactggccctgctgcgttttgtg
gtaaatgattacaactggaaaacccgacacgactttattgggcagtacacacttccttgg
acctgcatgcaacaaggtgggccggtcccccaaaccctggccagcggtccagctccggct
cccttcctaatgctgtcctcctgcccctttccaggctaccgccacatacacctactctcc
aaggacggcaccagcctccatccagcctccatctttgtgcatatctgcatccgggaagga
ctagagggggatgaatcctaa

DBGET integrated database retrieval system