KEGG   Felis catus (domestic cat): 101090594Help
Entry
101090594         CDS       T02385                                 

Gene name
XIAP
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
fca  Felis catus (domestic cat)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101090594 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    101090594 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101090594 (XIAP)
  Cellular commiunity
   04510 Focal adhesion
    101090594 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101090594 (XIAP)
   05222 Small cell lung cancer
    101090594 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    101090594 (XIAP)
   05145 Toxoplasmosis
    101090594 (XIAP)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    101090594 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 496 aa AA seqDB search
MTFNSFEASKPCVPADLSKDEDFVEEFNRLKTFTNFPSNSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENHAAQPTNPGIQNGQYKAESY
LGNRNHFVVERPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIEDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SDVSSDRNFPNSTNAPRNPAMADYEARIVTFGTWMYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQDYVTNIHLTHSLEDSMVRTAEKMPS
LTKRIDDAIFQDPMVQQAIRMGFNFRDIKKVMEEKIQTSGSNYKSLEILVTDLVSAQKDN
TQDEPSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKC
PMCYTIITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaagcatctaaaccttgtgtacctgcagatctcagtaaggat
gaagactttgtagaagagtttaatagattaaagactttcactaattttccaagtaatagt
cctgtctcggcatcaacgctggcacgagcgggttttctgtataccggcgaaggagacact
gtgcgctgcttcagctgccacgcagcagtagatagatggcaatatggagactcagcggtt
ggacgacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaat
catgctgcgcaacctacaaaccctggtatccaaaatggtcagtataaagctgaaagctat
ctgggaaacagaaatcattttgttgtagagaggccatctgagactcacgcagactatctt
ttgagaactggacaggtcgtagatatatcagacaccatatacccgaggaaccccgccatg
tatagtgaagaagctagattaaagtcatttcagaactggccagactatgcccacctgacc
ccaagagagttagctagcgctggactctactacacaggtattgaggatcaagtgcagtgc
ttttgttgtggcggaaaactgaaaaattgggaaccttgcgatcgtgcatggtcagaacac
aggcggcactttcctaattgcttctttgttttgggccggaatgtgaatgttcgaagtgaa
tctgatgtgagttctgataggaatttcccaaactcgacaaatgctccaagaaatccagcc
atggcagattatgaagcacggatcgttacttttgggacgtggatgtactccgttaacaag
gagcagcttgcaagagctggattttatgctttaggggaaggtgataaagtaaaatgcttt
cactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacatgct
aagtggtatccagggtgtaaatatctgttagaagagaagggacaagactatgtaaccaat
attcatttaacccattcacttgaggactctatggtaagaactgctgaaaaaatgccatca
ttaaccaaaagaattgatgatgccatcttccaagatcctatggtacagcaagctatacga
atgggattcaatttcagagacattaagaaagtaatggaagaaaaaattcagacatctggg
agcaactataaatcacttgagattctggttacagacctagtgagtgctcagaaagacaat
acacaggatgaaccaagccagacctcattgcagaaagagattagtgccgaagagcagcta
aggctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtggtt
tttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaatgt
cccatgtgctacacaatcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system