KEGG   Felis catus (domestic cat): 101090594Help
Entry
101090594         CDS       T02385                                 

Gene name
XIAP
Definition
(RefSeq) LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04064  NF-kappa B signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04510  Focal adhesion
fca04621  NOD-like receptor signaling pathway
fca05145  Toxoplasmosis
fca05166  HTLV-I infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101090594 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    101090594 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101090594 (XIAP)
   04215 Apoptosis - multiple species
    101090594 (XIAP)
   04217 Necroptosis
    101090594 (XIAP)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101090594 (XIAP)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    101090594 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101090594 (XIAP)
   05222 Small cell lung cancer
    101090594 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    101090594 (XIAP)
   05145 Toxoplasmosis
    101090594 (XIAP)
  Drug resistance
   01524 Platinum drug resistance
    101090594 (XIAP)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101090594 (XIAP)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101090594 (XIAP)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    101090594 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 DUF2039
Motif
Other DBs
NCBI-GeneID: 101090594
NCBI-ProteinID: XP_011277760
Ensembl: ENSFCAG00000012037
UniProt: M3WG83
Position
X
AA seq 496 aa AA seqDB search
MTFNSFEASKPCVPADLSKDEDFVEEFNRLKTFTNFPSNSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENHAAQPTNPGIQNGQYKAESY
LGNRNHFVVERPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIEDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SDVSSDRNFPNSTNAPRNPAMADYEARIVTFGTWMYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQDYVTNIHLTHSLEDSMVRTAEKMPS
LTKRIDDAIFQDPMVQQAIRMGFNFRDIKKVMEEKIQTSGSNYKSLEILVTDLVSAQKDN
TQDEPSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKC
PMCYTIITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaagcatctaaaccttgtgtacctgcagatctcagtaaggat
gaagactttgtagaagagtttaatagattaaagactttcactaattttccaagtaatagt
cctgtctcggcatcaacgctggcacgagcgggttttctgtataccggcgaaggagacact
gtgcgctgcttcagctgccacgcagcagtagatagatggcaatatggagactcagcggtt
ggacgacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaat
catgctgcgcaacctacaaaccctggtatccaaaatggtcagtataaagctgaaagctat
ctgggaaacagaaatcattttgttgtagagaggccatctgagactcacgcagactatctt
ttgagaactggacaggtcgtagatatatcagacaccatatacccgaggaaccccgccatg
tatagtgaagaagctagattaaagtcatttcagaactggccagactatgcccacctgacc
ccaagagagttagctagcgctggactctactacacaggtattgaggatcaagtgcagtgc
ttttgttgtggcggaaaactgaaaaattgggaaccttgcgatcgtgcatggtcagaacac
aggcggcactttcctaattgcttctttgttttgggccggaatgtgaatgttcgaagtgaa
tctgatgtgagttctgataggaatttcccaaactcgacaaatgctccaagaaatccagcc
atggcagattatgaagcacggatcgttacttttgggacgtggatgtactccgttaacaag
gagcagcttgcaagagctggattttatgctttaggggaaggtgataaagtaaaatgcttt
cactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacatgct
aagtggtatccagggtgtaaatatctgttagaagagaagggacaagactatgtaaccaat
attcatttaacccattcacttgaggactctatggtaagaactgctgaaaaaatgccatca
ttaaccaaaagaattgatgatgccatcttccaagatcctatggtacagcaagctatacga
atgggattcaatttcagagacattaagaaagtaatggaagaaaaaattcagacatctggg
agcaactataaatcacttgagattctggttacagacctagtgagtgctcagaaagacaat
acacaggatgaaccaagccagacctcattgcagaaagagattagtgccgaagagcagcta
aggctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtggtt
tttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaatgt
cccatgtgctacacaatcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system