KEGG   Felis catus (domestic cat): 101090611Help
Entry
101090611         CDS       T02385                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101090611 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101090611 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    101090611 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101090611 (SCD5)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101090611 (SCD5)
Lipid biosynthesis proteins [BR:fca01004]
 Desaturase
  First
   101090611 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
B1
AA seq 295 aa AA seqDB search
MEAKEVLVPTTTSWPAEVAQENSAVSSTSCSPILLSRMAGLVAYFCFLLSALGVTAGAHR
LWSHRSYKAKLPLRIFLAVANSMAFQNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSH
IGWLFVRKHPDVIEKGRKLDLTDLLADPVVRFQRKYYKITVVLMCFVIPTLVPWCAWEES
LWNSYFLASILRYTISLNISWLVNSAAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYH
HTFPFDYSASEFGLNFNPTTWFIDLMCWLGLATDRKRATKPMIKARKARTGDGST
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaaaagaagtgctggtgccaactacaaccagctggccagcagaagtggcccag
gagaactctgccgtgtcctccacatcctgttccccgattttgctctcaagaatggcaggc
ttggtggcgtacttctgcttcctcctatctgctctgggtgtgacagctggtgcccatcgc
ttgtggagccacaggtcctacaaagccaagctgcctctgaggatatttctggctgttgcc
aactccatggctttccagaatgacatcttcgagtggtccagggaccaccgagtccaccac
aagtactcagagaccgatgctgacccacacaatgcccgccggggcttcttcttctctcat
atcgggtggctctttgttcgcaaacatccagatgtcattgaaaaggggagaaaacttgac
ctcactgacctgctggctgatcctgtggtccgattccagagaaagtactataagatcact
gtggtgctcatgtgctttgtgatccccacgctggtaccctggtgtgcctgggaagagagt
ctgtggaactcctatttcttggcctccatcctccgctataccatctcactcaacatcagc
tggctggtcaacagtgctgcccacatgtatggaaaccggccctacgacaagcacatcagc
cctcggcagaacccactcgtcaccctgggtgccattggtgaaggcttccacaattaccac
catacctttccctttgactactctgcgagtgaatttggcttaaatttcaacccaaccact
tggttcattgacctcatgtgctggctgggactggccactgaccgcaaacgagcaaccaag
ccaatgatcaaggcccggaaagccaggactggagacggcagcacttga

DBGET integrated database retrieval system