KEGG   Felis catus (domestic cat): 101090719Help
Entry
101090719         CDS       T02385                                 

Definition
(RefSeq) HRAS-like suppressor 3 isoform X2
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00592  alpha-Linolenic acid metabolism
fca01100  Metabolic pathways
fca04014  Ras signaling pathway
fca04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101090719
   00565 Ether lipid metabolism
    101090719
   00590 Arachidonic acid metabolism
    101090719
   00591 Linoleic acid metabolism
    101090719
   00592 alpha-Linolenic acid metabolism
    101090719
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101090719
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101090719
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101090719
    3.1.1.32  phospholipase A1
     101090719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Calici_PP_N
Motif
Other DBs
NCBI-GeneID: 101090719
NCBI-ProteinID: XP_011285277
Ensembl: ENSFCAG00000001309
Position
D1
AA seq 162 aa AA seqDB search
MRASIPEPKVGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEMAGAGAASIMSTLTEKAVV
KKELLDDVVGRDRYQVNNKHDDKYSPLPPSKIVQRAEQLVGQELPYSLPCENCEHFVNEL
RYGVARSDQVRDAVVAAGIAGVGLAAVGLIGVMFSRNKRQKQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgtccatcccagagcccaaagttggagacctgattgagattttccgccctttc
tacagacactgggccatctacgttggcgatggatacgtggtccacctggcacccccaagt
gaaatggcgggagcgggcgcggccagcatcatgtccaccctgactgagaaggccgtggtg
aaaaaggagctgctggatgacgtggtcgggagagacaggtaccaggtcaataacaaacac
gatgacaagtactcgccgctgcctcccagcaaaatcgtccagcgggcggagcagctggtg
ggccaggagctgccctactcgctgccctgtgagaactgcgagcactttgtgaacgagctg
cgctacggagtcgcccgcagcgatcaggtcagagacgccgtcgtggcggctggcatcgcc
ggcgtgggcttggccgccgtgggcctcatcggagtcatgttctccagaaacaagcggcag
aagcaatga

DBGET integrated database retrieval system