KEGG   Felis catus (domestic cat): 101090801Help
Entry
101090801         CDS       T02385                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101090801 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D2
AA seq 2078 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLISTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
CKGAPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDLTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPPTPISGQSPSSQKSSTSASSTSPQSSSSQSSVPSFSSLTNNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKSELSSTAKSKAHFFGKRDIRSRFLAH
SSSSSWGMARGRIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKISIKQESTDINVLGNKDTVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTXNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHQERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILGHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSSRANSRQSPAKVQSKNKYLHSPESRPVAGERGQLMELSKESSEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKR
PFVLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERPMPHLEPTCEIEVEEDGG
KPVLRKAFQHQPGKKRKTEEEEEKDNHCFKNADPCRNNMDDDTDNLKEGSRDNLEPLKCK
QVWPKGTKRSLSKWRPNKERKTGFKLNLYTPPETPMEPDDQITVEEQKETPEGKTSPTPT
RIEEEVKEAVEPLLPRDENTRDETCAPISPNKSPGEKPEDDLIKPEEEEEEEEEEEEEEE
EENVEKDPGGAKNQEKEEPEVFTDKEDPVPLDDHEEEEEEDEEPSHNEGHDADDEDDSHM
ECGEAEKEERPRESFKEVLENQEAFLDLSVQPSHSNSEVLMECGVDLAAACNSEPKELSR
DTEAAPESDEESPEEQAQKQDQKSGEEVDSEFKERNTTAMEIDSETVQAVQSLTQENSEQ
DDTFQDCAETQEACRSLQNYTHADQSPQIAATLDDCQQSDHSSPVSSVHSHPGQSVRSVN
SPSVPALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIES
TTENYENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSNLTQSSCAVTQQMSNISGSCSML
QQTSISSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLADIPETGNANIGLY
ERMGQSDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSN
TGLVQLSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQT
QIASKGHVSMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAP
AYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQ
QPMQTPPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6237 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcagtcagcacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
cttaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcaaccaaggggtctaggggatcatgtaat
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggactcgaggag
ccaaatggctcctccctgaagaacatcgagaagtatctcagaagtcaaagtgatctcata
agcaccaccaacaacccagcctttcagcagcggctgcgactaggggccaaacgtgcagtg
aacaatgggaggttactgaaagatggaccgcagtacagggtcaattatggaagcttagac
tgcaaaggggctcccaagtatcccagtgctttcccgtcctcgctaccacctgtcagcctt
ctaccccatgagaaagatcagccccgtgccgatcccattccgatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagagctcctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgagtgcaagacatgcagtgcatgtagaatccaaggcaaa
aatgcagataatatgcttttttgtgactcctgtgatagaggattccatatggagtgctgt
gaccccccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagacctcactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactaccgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttccacccccaacccccatc
tccggtcagagccccagttcacaaaagtccagcacttccgcctcttctacctctccccag
agttcttccagccagtccagtgtgccctcctttagcagtcttactaataacagccagctg
aaggcactctttgatggactttctcatatctataccactcagggacagtctcgaaaaaag
ggacacccaagttatgcaccacccaaacgtatgcgtcgtaaatctgaattatcttccacg
gcaaaatctaaagcccatttctttggaaaacgagatattagaagtaggtttcttgctcac
tcctcctcctctagctgggggatggctagaggacgtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaatcaaaataagcatcaaacaagaaagtacagatataaat
gtgcttggaaacaaggataccgttactgaagaggacttggatgtttttaagcaggcccag
gaactttcttgggagaaaatagagtgtgaaagtggggtggaagactgtggccggtaccct
tctgtaatagaattcgggaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttgttaagacactcaaagaaatgtggatggtttcatcctccagcaaatgaa
atttaccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgat
gtcgagccattccttttttatgtccttacannaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctagaagagaaggccaagcagggtctcctgaaaagccactctccgatctgggccgtctc
tcctacctggcctattggaagagtgtcatcttagaatatctctaccaccaccaggagagg
cacatcagcatcaaggcgatcagcagagctacaggcatgtgcccacatgacatcgccacc
actctgcagcacctccatatgattgacaagagggatggcagatttgtcatcattagaagg
gaaaagttgatactgggccacatggaaaagctgaaaacctgttcccggaccaatgaactt
gatccagagagtctaagatggaccccaattttaatttctaatgctgcagtttctgaagaa
gagcgagaagctgagaaagaggccgagcggctaatggaacaagctagctgctgggaaaag
gaggagcaagaaatcctgtcctctagagcgaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtggcaggggagcgagggcag
cttatggagctgtctaaagagagcagtgaagaggaggaggaggaggaggaagaggaggag
gaggaggaggaggaagaggaggaagaggaggaggaggaggaagaagaggaggaggaggag
gaggaggaagaggaggaggaagaagaggaagaggaggaagaggaggaggaagaagaaaat
attcagagttctcctccaagattgactaaaccacaatcagttgctataaagagaaagcgg
ccttttgtactaaagaagaaaaggggtcgtaaacgcaggaggatcaacagcagtgtaaca
actgagaccatttctgagacgacagaagtactgaatgagccctttgacaactcagatgaa
gagaggccaatgccgcacctggagcctacctgtgagattgaagtggaggaagatggaggg
aagccagtcctgagaaaagcattccaacatcagcctgggaagaaaagaaaaacagaggaa
gaggaagaaaaagacaatcattgttttaagaatgctgacccttgtagaaacaatatggat
gatgatacagataacttgaaagaaggcagtagagacaatcttgaacctctaaagtgcaaa
caagtgtggccaaaaggaacaaaacgtagtctatctaagtggaggccaaacaaagagagg
aagaccggatttaaactgaacttgtacaccccgccagaaacacccatggaacctgatgac
cagataacagtagaagaacagaaggagactccagaaggcaaaaccagccctactcccacc
aggattgaggaggaagtcaaggaagccgtggaacccctgctgcctcgggatgaaaacaca
agggatgaaacatgtgcaccgataagtccaaataaatcaccaggtgaaaaaccagaagat
gatctaatcaaacccgaggaggaagaagaggaggaggaagaagaggaagaggaggaagaa
gaagaaaatgtagaaaaagacccaggtggtgctaaaaatcaggaaaaagaggaaccagaa
gtcttcacggacaaagaagaccctgttcctctggatgatcatgaagaggaggaggaagag
gatgaagagccatctcacaatgagggtcatgatgcagatgatgaagatgacagtcacatg
gagtgtggagaagcagagaaggaagaacgcccaagagaatcctttaaagaagtactagaa
aaccaggaggcttttttagaccttagtgtccagcctagtcattcgaactcagaggtccta
atggagtgtggcgttgaccttgcagctgcgtgtaacagtgaacctaaggagctttctaga
gacactgaagctgcacctgaatctgatgaggaatccccagaagaacaggcacagaagcag
gaccaaaagagtggcgaagaagtggattctgagttcaaagagagaaacacgacggccatg
gaaattgactctgagaccgttcaggcagttcaatctttgacccaggagaatagtgaacag
gacgacacttttcaggattgtgctgagactcaagaggcctgcagaagcctacaaaactac
acccatgcagaccaaagcccacagatagccgccactctagatgattgccagcagtcagac
cacagtagcccagtttcatccgtccattcccatcctggccagtcagtacgttctgtcaac
agcccaagtgtccctgccctggaaaacagctatgcccaaatcagcccggatcaaagtgcc
atctccgtgccgtctttgcaaaacatggaaaccagtccaatgatggatgtcccgtcagtt
tcagatcattcccagcaagtcgtggacagtggatttagtgacctgggcagtatcgagagc
acaaccgagaactacgagaaccctagtagctatgattctactatgggcggcagcatttgc
ggaaacggctcttcacagaacagctgctcctatagcaacctcacctctagcaatctgaca
cagagcagctgtgctgtcacccagcagatgtccaacatcagtgggagctgcagcatgctg
cagcaaaccagcatcagttctcccccaacctgcagcgtcaagtctcctcaaggctgtgtg
gtggagaggcctccgagcagcagccagcagctggctcagtgtagcatggccgctaacttc
accccaccgatgcagctggccgacatccctgagactggcaacgccaacattggcttatat
gaacgaatgggtcagagtgattttggggctgggcattacccacagccatcagccaccttc
agccttgccaaactacagcagttaactaatacacttattgatcattcattgccttacagc
cattccgctgctgtaacttcctatgcaaacagtgcctctttgtccacaccattaagtaac
acagggcttgtccagctttctcagtctccgcactctgtccctgggggaccccaagcacaa
gctacaatgaccccaccccccaacctgactcctcctccgatgaatctgccaccgcctctt
ttgcaacggaacatggctgcatcaaacattggcatctctcacagccaaagactgcaaacc
cagattgccagcaagggccacgtctccatgagaaccaaatcggcatctctgtcaccagcc
gctgccacccatcagtctcagatctatgggcgctcccagactgtagccatgcagggtcct
gcacggactttaacgatgcagagaggtatgaacatgagtgtgaacctgatgccagcccca
gcctacaatgtcaactctgtgaacatgaacatgaatactctcaatgccatgaatgggtac
agcatgtcccagccgatgatgaacagcggctaccacagcaatcatggctacatgaatcaa
acaccccaataccctatgcagatgcagatgggcatgatgggaacccagccatatgcccag
cagccaatgcagaccccgccccatggtaacatgatgtacacggcccccggacatcacggc
tacatgaacacgggcatgtccaaacagtctctcaatgggtcctacatgagaaggtag

DBGET integrated database retrieval system