KEGG   Felis catus (domestic cat): 101090803Help
Entry
101090803         CDS       T02385                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
fca  Felis catus (domestic cat)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fca01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fca00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D2
AA seq 797 aa AA seqDB search
MLSQVYRSGFQSVSFRQRLLPWVQSTALSRSHRVQPSAIRHVRSWSNIPFITVPLSRTHG
KSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSG
AVAFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFT
QYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGV
NVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFG
TKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKP
AGPTVEQQGEMARAGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRL
AAPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLV
IFESRPDCLPQVAALAIASGNGLLLKGGKEATHSNRILHLLAQEALSIHGVKEAIQLVNT
REEVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKAT
RLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSP
SEVKSLRTEYGDLELCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSAC
VFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHG
SLKYLHENLPVPQRNTN
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtcaagtctaccgctctgggttccagagcgtctccttccgccagcgtctcctg
ccctgggtccagtccacagccctctccagatctcaccgtgtccagccttcagccatcaga
catgttcgttcttggagcaacatcccctttatcactgtccccctcagtcgtacacatggc
aagtcttttgcccaccgcagtgagctgaagcatgccaagagaatcgtggtgaaacttgga
agtgccgtagtaacccggggggatgagtgtggccttgcactggggcgcctggcatctatt
gttgagcaggtgtcagtgctacagaatcaaggccgagagatgatgctggtgaccagtgga
gccgtggcctttggcaagcaacgcttgcgccatgagatccttctgtctcagagcgtgcgg
caggccctgcactcagggcagaaccagttgaaagagatggcaattccagtcttagaagca
cgagcctgtgcagccgccggacagagtgggctgatggccttgtatgaggccatgtttacc
cagtacagcatctgtgccgcccagattttggtgaccaacttggatttccatgatgagcag
aagcgccggaaccttaatgggacacttcatgagctcctccgaatgaacatcgttcccatt
gtcaacacaaatgatgctgtcgtgcccccagctgagcccaatagtgatctccagggggta
aatgttattagtgttaaagataatgatagcctggctgcccgtctggctgtggaaatgaaa
actgacctcttgattgttctttcagatgtagaaggtctctttgacagccccccagggtca
gatgatgcaaagctcattgatatattttatcccggagatcagcagtctgtgacctttgga
accaagtcaagagtaggcatgggtggcatggaagccaaggtgaaagcggccctctgggct
ttgcaaggtggcacttctgtggttattgccaacggaacccacccaaaggtgtctggacat
gtcatcacagacattgtggagggaaagaaagttggcaccttcttttctgaagtaaagcct
gcaggtcctaccgttgaacagcagggagaaatggctcgagcaggaggaaggatgttggcc
actttggaacctgagcagagagcagagattatccatcatctggctgatctgttgacggac
cagcgtgatgagatcctgttagccaacaagaaagacttggaggaggcagaggggagactc
gcagctcctctgctgaaacgtttgagcctctccacatctaaattgaacagcctggccatc
ggtctacggcagatcgcagcctcctcacaggacagcgtggggcgtgttttgcgtcgaacc
cgaattgccaaaaacttggagctagaacaagtgactgtcccaattggagtcctgctggtc
atctttgagtctcgcccagactgtctaccccaggtggcagccttggctatagcaagtggt
aatggcttattactcaaaggagggaaggaggccacacacagcaaccggattcttcatctt
ttggcccaagaggccctctcaatccatggagtcaaggaggccatacagctggtgaatacc
agagaagaagtggaagatctttgtcgcctagataaaatgatagatctgattattccacgt
ggctcttcccagctggtcagagatatccagaaagctgctaaggggatcccggtgatggga
cacagtgaggggatctgccacatgtatgtggattcagaggccagcgtcgataaagccacc
agactggtccgagactctaaatgtgaatatccagctgcctgtaatgctttggagactctg
ttaattcaccgagatctgctgagaacaccattatttgaccagatcattgacatgctgaga
gtggaacaggtgaaaattcacgcgggccccaagttcgcctcctatctgaccttcagcccc
tccgaagttaagtccctccgaactgagtatggggacctggaattgtgcattgaagtggtg
gacagcgtccaggaggccatcgaccacatccacaagtatggcagctcgcacacagatgtc
atcgtcacggagaatgagaaaacagcagagttcttcctccagcacgtagatagtgcctgt
gtgttctggaatgccagcactcgcttctctgatggctaccgctttggactgggagctgag
gtgggcatcagtacgtcacggatccacgcacggggaccagtaggattggagggactgctc
actacaaagtggctactgcgggggcaggaccacgtggtctccgatttctctgagcacgga
agtttgaaatatcttcacgagaacctccctgtgcctcagagaaacaccaactga

DBGET integrated database retrieval system