KEGG   Felis catus (domestic cat): 101090936Help
Entry
101090936         CDS       T02385                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101090936 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101090936 (MGST2)
   00982 Drug metabolism - cytochrome P450
    101090936 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101090936 (MGST2)
   05204 Chemical carcinogenesis
    101090936 (MGST2)
   05225 Hepatocellular carcinoma
    101090936 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101090936 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    101090936 (MGST2)
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101090936 (MGST2)
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   101090936 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
B1
AA seq 146 aa AA seqDB search
MAGHSILLAAVSVLSACQQSYFALHVGKARLKYKVTAPAVSGSPEFERIFRAQQNCVEFY
PIFLITLWMAGWYFNQVFATCLGLVYIYARHQYFWGYSEAAKKRITGFRLSLAILALLTV
LGTLGIANSFLDEYMDLNVAKKLRRF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcattcaatcttgctggccgctgtctcagtcttgtccgcctgtcaacaaagt
tattttgctttgcatgtaggaaaggcaagattgaaatacaaagttacagccccagcagtc
tctgggtcaccagagtttgagagaatatttcgtgcacaacaaaactgtgtggagttttac
cccatatttctgattacattgtggatggctggatggtatttcaatcaagtttttgctacc
tgtctgggtcttgtgtacatatatgcccgtcaccagtatttctggggatattcagaagca
gctaaaaaaaggatcaccgggttccggctgagtctggcgattctggccttgctgacagtc
ctgggcaccctggggattgcaaacagctttctggatgaatacatggacctcaatgtcgcc
aagaaactgagacgcttctaa

DBGET integrated database retrieval system