KEGG   Felis catus (domestic cat): 101090942Help
Entry
101090942         CDS       T02385                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04062  Chemokine signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing's syndrome
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca05010  Alzheimer's disease
fca05016  Huntington's disease
fca05142  Chagas disease (American trypanosomiasis)
fca05143  African trypanosomiasis
fca05146  Amoebiasis
fca05200  Pathways in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101090942 (PLCB2)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101090942 (PLCB2)
   04310 Wnt signaling pathway
    101090942 (PLCB2)
   04371 Apelin signaling pathway
    101090942 (PLCB2)
   04020 Calcium signaling pathway
    101090942 (PLCB2)
   04070 Phosphatidylinositol signaling system
    101090942 (PLCB2)
   04072 Phospholipase D signaling pathway
    101090942 (PLCB2)
   04071 Sphingolipid signaling pathway
    101090942 (PLCB2)
   04022 cGMP - PKG signaling pathway
    101090942 (PLCB2)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101090942 (PLCB2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101090942 (PLCB2)
   04621 NOD-like receptor signaling pathway
    101090942 (PLCB2)
   04062 Chemokine signaling pathway
    101090942 (PLCB2)
  Endocrine system
   04911 Insulin secretion
    101090942 (PLCB2)
   04922 Glucagon signaling pathway
    101090942 (PLCB2)
   04912 GnRH signaling pathway
    101090942 (PLCB2)
   04915 Estrogen signaling pathway
    101090942 (PLCB2)
   04921 Oxytocin signaling pathway
    101090942 (PLCB2)
   04926 Relaxin signaling pathway
    101090942 (PLCB2)
   04918 Thyroid hormone synthesis
    101090942 (PLCB2)
   04919 Thyroid hormone signaling pathway
    101090942 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    101090942 (PLCB2)
   04916 Melanogenesis
    101090942 (PLCB2)
   04924 Renin secretion
    101090942 (PLCB2)
   04925 Aldosterone synthesis and secretion
    101090942 (PLCB2)
   04927 Cortisol synthesis and secretion
    101090942 (PLCB2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101090942 (PLCB2)
   04270 Vascular smooth muscle contraction
    101090942 (PLCB2)
  Digestive system
   04970 Salivary secretion
    101090942 (PLCB2)
   04971 Gastric acid secretion
    101090942 (PLCB2)
   04972 Pancreatic secretion
    101090942 (PLCB2)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101090942 (PLCB2)
  Nervous system
   04724 Glutamatergic synapse
    101090942 (PLCB2)
   04725 Cholinergic synapse
    101090942 (PLCB2)
   04728 Dopaminergic synapse
    101090942 (PLCB2)
   04726 Serotonergic synapse
    101090942 (PLCB2)
   04720 Long-term potentiation
    101090942 (PLCB2)
   04730 Long-term depression
    101090942 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    101090942 (PLCB2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101090942 (PLCB2)
  Environmental adaptation
   04713 Circadian entrainment
    101090942 (PLCB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101090942 (PLCB2)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101090942 (PLCB2)
   05016 Huntington's disease
    101090942 (PLCB2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101090942 (PLCB2)
   04934 Cushing's syndrome
    101090942 (PLCB2)
  Infectious diseases
   05146 Amoebiasis
    101090942 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    101090942 (PLCB2)
   05143 African trypanosomiasis
    101090942 (PLCB2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101090942 (PLCB2)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101090942 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101090942 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PI-PLC-Y EF-hand_like C2 AAA_13 Lectin_N Gp58
Motif
Other DBs
NCBI-GeneID: 101090942
NCBI-ProteinID: XP_023111263
Ensembl: ENSFCAG00000001138
Position
B3
AA seq 1195 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEIEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPENNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGQNWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALSSCHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVRGLIDKYEPSAINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLYQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGRPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPASPSKEPGGE
AEGDCPPSASVGEGTAWAGEEGAEPEEEEVEEEEESGSLNEEEIKKMQSDEGTAGLEVTA
YEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMSR
IYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMR
RPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKL
SPSANSINPVWKEEPFVFEKILMPELASLRVAVMEEGNRFLGHRIIPINALNSGYHHLCL
HSESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKFFSAHDKKSVKLKEAIGGLPE
KPFPPGSPVAGHVNGALAPLSNGSAAHAVALAAAGARARAREDAVKEAAEPRTASLEELR
ELKGVVKLQRRHEKELRDLERRGARRWEELLQRGAAQLTELGQPGPGGCGGRSLGASKGS
RKKRTPLCEEAAGAAPSEGREGPEGADARARELKDRLELELLQQGEERYECILKRKEQHV
AEQIAKMMELAREKQAAELKTLKETLETDTKEMKKKLEAKRIERIQAMVKVTSDKMAQER
LKREINNSHIQEVVQAIKQMTENLEKHQEKLEEKQAACLEQIREMEKQFQQEALAEYEAK
MKGLEAEVKESVRTCLRDCFPSEAKDKPERSFGAFKELCEQDPLTAKADAQESRL
NT seq 3588 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcttatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaaccacaatagcctccccggttatcctccgcgtg
gatcccaagggctactacttatattggacatatcagagtaaggagatagagtttctggat
atcaccagcatcagggatactcgctttgggaagtttgccaagatacccaagagccagaag
ctccgggatgtcttcaacatggactttcctgagaacaacttcctgctaaagacgctcact
gtggtgtctggcccggacatggtggacctcaccttccacaactttgtctcctacaaggag
aacgtaggccagaactgggctgaagatgtcctggctctggtcaagcacccgctgacagcc
aatgcctctcgcagcaccttcctggacaaaatcctggtaaagctcaagatgcagctcaat
cccgaagggaagattcctgtgaagaattttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgccctcagctcctgccacctccccaaaggcaagaatgatgccatcaatcct
gaggacttcccagaatccgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcctaccacgccaaggccaagccctacatgaccaaggaacac
ctgaccaaattcatcaaccagaaacagagggactcccgcctcaactctttgctgtttccg
cccgcccggcctgaccaagtgcggggcctcatcgacaagtacgagcccagcgcaatcaac
gtgcagaggggccagctgtcacctgagggcatggtgtggtttctctgtgggccagagaac
agtgtgctggcccaggacaagctgctactctaccaagacatgacacagccactcaaccat
tacttcatcaactcctcacacaacacctacctgacagctggccagttctctggcctttcc
tcggcagagatgtaccgccaggtgctgctggctggctgtcgctgcgtggagctggactgc
tggaagggcaggccccctgacgaggagcccatcatcacccacggctttaccatgaccaca
gacatctatttcaaggaagcaattgaagccattgcagaaagtgcttttaagacctccccc
tatcctgtcatcctgtcatttgaaaaccatgtggactcaccccgccaacaggccaagatg
gctgagtattgccggacgatgtttggggacatgctactcacagagcccctggaaaagttc
ccactgaaaccaggcatccccctgcccagccccgaggatctccgaggcaagatcctcatc
aagaacaaaaagaaccagttttctggcccagcatcccccagcaaggagccgggtggggag
gcggagggcgactgcccacccagtgcctctgtgggtgagggcacagcgtgggctggtgaa
gaaggagcagagccggaggaggaagaggtggaagaggaggaggagtcgggaagcctgaat
gaggaagagatcaagaagatgcagtcggacgagggcacagcgggcctggaggtgacggct
tatgaggagatgtccagcctagtgaattacattcaacccaccaagttcatctcctttgag
ttctctgcccagaagaaccgaagttatgtcatctcctccttcacagagctcaaggcttac
gacctgctctccaaggcctcagtgcagtttgtggactacaacaagcgccagatgagccgc
atttaccctaagggcacccgcatggactcctccaactacatgccccagatgttctggaat
gctggttgccagatggttgccctcaacttccagacgatggacctgcccatgcagcagaac
atggcgctgtttgagttcaatgggcagagtggctacctcctcaagcatgagttcatgcgc
cggccagacaagcagttcaaccccttctcagtggaccgcatcgatgtggtggtagccacc
accctctccattacggtgatctctgggcagttcctgtcagaacgcagtgtgcgcacctat
gtcgaagtggagctgtttggccttcctggggaccccaagaggcgctatcgcaccaagctg
tcacccagtgccaactctatcaatcctgtctggaaggaggagccctttgtctttgagaag
atcttgatgcctgagctggcctccctcagggtggctgtaatggaggaaggcaacagattt
cttggacaccgcatcatccccattaatgccctgaattctggctaccaccatctgtgcctg
cacagcgagagcaacatgccccttaccatgcctgcgctttttgtcttcctggagatgaag
gactacgtacctgacacctgggcagatctcaccgtggctcttgccaatcccatcaagttc
ttcagtgcccacgataagaagtctgtgaagctcaaggaagccataggaggtctgcctgag
aaacccttcccacccgggagtccggtcgccggccacgtcaatggggcactggccccactg
agcaacgggtctgcagcccacgctgtggctcttgcagcagccggggccagggccagggcc
agggaggacgccgtgaaagaagctgcggagccgcggacggccagcctggaggagctgcgg
gagctgaagggcgtcgtgaagctgcagcggcggcacgagaaggagctgcgggacctggag
cggcgcggcgcgcggcgctgggaggagctgctgcagaggggcgcggcgcagctgaccgag
ctggggcagccgggcccggggggctgtgggggccgcagtctcggcgcgagcaagggttcc
cgcaagaagaggaccccgctctgcgaggaggccgccggggccgcgccgagcgagggccgc
gagggccccgagggcgcggacgcgcgcgcgcgggagctgaaggaccgcctggagctggag
ctgctgcagcagggcgaggagcggtacgagtgcatcctgaagcgcaaggagcagcacgtg
gccgagcaaatcgccaagatgatggagctggccagagagaagcaggctgcggagctgaag
accctcaaggagaccttggagactgataccaaagagatgaagaagaagctggaggccaag
aggatagagcggatccaggccatggtcaaagtcacctcggacaagatggctcaagaaagg
ctgaagagagagattaacaactctcacattcaggaggtggtgcaagccatcaagcagatg
acagagaacctggagaagcaccaggagaagctggaggagaagcaggcagcttgcctggag
cagatccgggagatggaaaagcagttccagcaggaggcactggcagagtacgaggccaag
atgaagggcttggaggccgaggtgaaggagtcagtgaggacctgcctcagggactgcttc
ccctctgaggccaaggacaagcctgagaggtcctttggggccttcaaggagctgtgtgag
caggacccactcacagcaaaggcagatgcccaggagagtcgcctctga

DBGET integrated database retrieval system