KEGG   Felis catus (domestic cat): 101091070Help
Entry
101091070         CDS       T02385                                 

Gene name
SETD1A
Definition
(RefSeq) SET domain containing 1A
  KO
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101091070 (SETD1A)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101091070 (SETD1A)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101091070 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     101091070 (SETD1A)
    COMPASS/SET1 complex (yeast)
     101091070 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
E3
AA seq 1708 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTESRRRSSSDTAAYPAGSAGVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASAAPTTTSTAASATTAATASSSSSSSSSSSLSSSSSSSSSSSSS
HFRGTDSNYPAYYESWNRYQRHASYPPRRATREEPPGASFAENAAERFPPSYTSYLPPEP
SRPADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTN
ESVPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSTTGPGSRDIGSEVPSGSGHG
PCTPPPAPANFEDVAPTGSGEPGVTRESPKANGQNQASPCSSGEDMEISDDDRGGSPPPA
PTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIY
DFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLP
FPPPQEAAYGLPYALYTQGQEGRGAYSREAYHLPLPMAAEPLPSSSVSGEEARLPPREEA
ELAEGKALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPF
QNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKR
KEPSEISEASEEKRPRPSTPAEEDEDDPEREKEAGEPGRPGTKPPKRDEERSKTQGKHRK
SFALDSEGEEASQESSSEKDEEDDEEDEDDEEREEAMDTTKKETEASDGEDGESDSSSKC
SLYADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSSESSSEEEEEEEQPATIPST
SPPPRDVPAPLPAPVEEPEPERVAGSPVTPLPEQEKSPARPVGSTEEPPPSVPQPPPEPP
AGPPAPAHRPDERPSSPIPLLPPPKKRRKTVSFSAVEEVPAPEPPPAAPPQIKSPGPISR
KVPRAVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRSTEEEEAEPGTEVDLAVLA
DLALTPARRGPAALPPGDDSEATETSDEADRPGPLLSHILLEHNYALAVKPPPSTPAPRP
VEPVPAPAALFSSPADEVLEAPEVVVAEAEEPKQQQQQQQEEGEEEEEEEEESESSESSS
SSSSDGEGAVRRRSLRSHARRRRPPPXPPPPPPPSFEPRSEFEQMTILYDIWNSGLDLED
MGYLRLTYERLLQQTSGADWLNDTHWVHHTITNLSTPKRKRRPQDGPREHQTGSARSEGY
YPISKKEKDRYLDVCPVSARQLEGADTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLK
LNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGI
GSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEE
ITYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 5127 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaagccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccttgcgcaggccttctcaaaaggtgtac
cgctatgatggagtccacttcagtgtcaacgactcaaaatacataccagtcgaagacctc
caagacccccgatgccacgtcaggtccaaaaacagagacttttccctcccagtccctaag
tttaagctggatgagttctatatcggacagatccctctgaaggaagtgactttcgcgagg
ctgaatgacaatgtgcgggagaccttcttaaaggatatgtgccgaaagtatggtgaggtg
gaagaggtagagatccttcttcacccccgtactcgcaagcacctgggcctggcccgcgtg
ctcttcactagcactcggggagccaaggaaacagtcaaaaacctccatcttacctccgtc
atgggcaacatcatccacgcccagctcgacatcaaaggacaacaacgaatgaaatactat
gaactgatagtcaatggctcctacacccctcagacggtgcccactgggggcaaggcgctg
agcgagaagttccagggctctggtgcagccactgagacgactgaatcccgccgccgctcc
tcctctgacacggctgcttacccggcgggctctgctggggtgggcactcctggcaatggc
accccctgctcccaggacacaagcttctccagcagccgacaagacaccccatcttccttt
ggccaattcacccctcagtcctcccaaggaaccccttacacatctcggggcagcaccccc
tactctcaggactctgcctactccagcagcaccacttcaacctccttcaagcctcggcgg
tcagagaacagctaccaagattctttttcccgccgccatttctctgcatctgcagccccc
acgaccacctctacagctgcctccgccactactgcagccactgcctcgtcctcctcctca
tcttcctcctcctcttcgttgtcctcgtcctcttcatcctcctcttcgtcctcatcctct
cattttcgtggtactgactcaaactacccagcgtactatgaaagctggaatcgctaccaa
cgccatgcttcctaccctccccgccgtgcaactcgggaggagccccctggggcatctttt
gctgaaaatgcagctgagcgcttcccaccttcctacacctcctacttgccccctgagccc
agccggcctgctgaccaggactaccggcctcctgcctcagaagctccacccccagagcct
ccagaacctggtggaggcgggggtgggggagggcccagccctgagagagaagaagctcgg
acctccccccgcccagcctcacctgcccgctccggctccccagccccagagaccaccaat
gagagtgtgcccttcgctcagcatagcagcttggattcccgcattgagatgttgctgaag
gagcagcgctccaagttttcgttcctggcctctgacacagaggaagaggaagagaacagc
accacaggccctgggtctagagacatagggagtgaggtgccttctgggtcaggtcatggg
ccctgcacgccccctccagccccagctaattttgaggatgtggcacctacagggagtggg
gaaccaggggttacccgcgagtctcccaaggccaacggacagaaccaggcttctccgtgc
tcttcgggagaggatatggagatctctgatgatgacaggggcggttcaccccctccggcc
ccaacacccccccagcagcctccaccccctcctccaccaccccctcctcctcctccctac
ctggcttccctaccccttggttatcctccccatcagcctgcctacctcctcccaccacgc
cctgatgggccaccaccccctgagtaccccccacctcctccgccacccccccacatttat
gactttgtgaattccctagagctcatggatcgacttggggctcagtggggagggatgccc
atgtccttccagatgcagacccagatgttaactcggctccatcagctgcggcagggcaag
ggattgactgctgcctcagctggcccccctggtggggcctttggggaggccttcctccca
ttcccacccccccaagaggcagcctacggcttaccctacgctctgtacacacaagggcaa
gaaggccgaggggcatactcccgggaggcataccacctgcctttgcccatggcagctgag
cccctgccctcctcctcggtctctggagaagaggcccggctacctcccagggaggaagca
gagctggcagagggcaaggccctaccgtcagcaggcaccgtggggcgtgtgctggccacc
ctagtccaagagatgaagagcatcatgcagcgagacctcaaccgcaagatggtggagaat
gtggcctttggagcctttgaccagtggtgggagagcaaggaagagaaggccaagccattc
cagaacgcagccaaacagcaagccaaggaggaggataaagagaagacaaaactcaaagag
ccaggcctgctgtccctcgtagactgggccaagagtgggggtaccacgggcatcgaggcc
ttcgcttttgggtcagggctgcgaggggccctgcggctgccttctttcaaggtaaagcga
aaagagccttcggaaatttcagaggccagtgaggaaaagaggccccggccctccactcca
gctgaggaggatgaagatgaccctgagcgagagaaggaggctggagagccgggacgtccg
ggaaccaagcccccaaaacgagatgaagagcgaagcaagacccagggcaagcaccgcaaa
tcctttgctctggacagtgagggggaggaagcatcccaggagtcctcctcagagaaggat
gaggaggatgatgaggaagatgaagacgatgaagaacgtgaggaagccatggatactaca
aagaaggagacagaggcatcagatggcgaggacggggaaagcgattcgtcctccaaatgt
tctctgtatgccgactcagatggtgaaaatgatagcacgtcagactccgagagcagcagc
tcatccagctcgtcatcgtcctcatcttcctcctcctcatcctcctcatcctcctcatca
tctgagtcctcctctgaagaagaagaggaagaggagcagccagcaaccataccctcaacg
tcccctccccccagagacgtccctgcgcccctgccagcgccggtggaagagcccgagcca
gagcgggttgcaggctccccagtcacacctctccctgaacaggagaagtctccggcaaga
cctgtaggttccaccgaggaaccacctcccagtgtgccccagcctccccctgagccgcca
gcaggtcccccagcccccgcccaccgccctgacgagcgcccctcctctcctatccctctc
ctgcccccacccaagaaacgccggaaaaccgtctccttctctgctgtggaggaggtgccg
gcaccagagcctcccccagctgccccaccacagatcaagtctcctggacccatctcccgc
aaagttccccgggccgtggagcggaccattcgaaacctgcccctggaccatgcgtccctg
gtcaagagttggcccgaggaggtgtcccgaggaggtcggagcagggctggaggccgaggc
cgctctactgaggaggaagaagctgagccagggacagaagtggacctggcagtgctagcc
gacctggccctgaccccagcccgtcgtgggccagccgccctgcctcctggcgatgactcg
gaggccacagagacatcagatgaggcggaccgcccgggccccctcctcagccacatcctc
ctggagcacaactacgccttggccgtcaagccgccgccctccacaccggcccctcggccc
gtggagccagttcctgcccctgcagccctcttcagctccccagcagatgaggtcctagag
gcccctgaggtggtagtggctgaggcagaggagccaaagcagcagcagcagcagcagcaa
gaggaaggcgaggaggaggaggaggaggaagaggagtcagagtcatccgagagcagcagc
agcagcagcagtgacggggagggtgccgttcggcgtcgcagcctccgctcccatgctcgg
cgcaggcggcctcccccgncccccccaccccctccacccccctccttcgagccccgcagt
gagtttgagcagatgaccatcctgtatgacatttggaactcaggcctggacttggaggac
atgggctacctgcggctcacatacgagcggctactgcagcagacaagcggggctgactgg
cttaacgacacccactgggtccatcacaccatcaccaacctgagcactccaaaacgcaag
cggcggccccaggatgggccccgtgagcaccagacaggctcagcccgaagtgaaggctat
taccccatcagcaagaaggaaaaagacaggtacctggatgtgtgtcctgtttctgcccgg
cagctagaaggagcggacactcaggggactaaccgtgtgctttcggagcgccggtctgag
cagcggcggctgctgagtgccattggcacctctgccatcatggacagtgatctgctaaag
ctaaaccagctcaagttccggaagaagaagctccgattcggccggagccggatccatgag
tggggactgtttgccatggaacccatcgcagctgacgagatggtcatcgaatacgtgggt
cagaacatccgccagatggtggccgacatgcgggagaagcgctacgtgcaggaaggcatc
ggcagcagctacctgttccgggtggaccatgacaccatcatcgatgccaccaagtgcggc
aacctggcgaggttcatcaaccactgctgcacgcccaactgctatgccaaggtgatcacc
atcgagtcccagaagaagattgtgatttactccaagcagcccatcggtgtggatgaggag
atcacctatgactacaagttcccgctggaggacaacaagatcccatgtctgtgtggcacc
gagagctgccgtggctccctcaactga

DBGET integrated database retrieval system