KEGG   Felis catus (domestic cat): 101091077Help
Entry
101091077         CDS       T02385                                 

Gene name
DYRK3
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4  [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
F1
AA seq 587 aa AA seqDB search
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPLPR
RLNTTAEQVARDHTQRFMNGGEVKVEQLFQEFGNRRSDTLQSDGISDSEKCSPTVSQGKS
SDSSNAVKPSSSAKASKVVPLTPEQALKQYKHHLTAYEKLEIVNYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGLPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWVTALKGCDDCLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTIEKVSGKRV
VNPANAFQGLGSKLPPVVGIANKLKANLMSESNGGIPLCSVLPKLIS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcacggctcgcgggcccgggcggaaggatgcggggccgcccggagccggactc
ccgccccagcagcggagattgggggatggtgtctatgataccttcatgatgatagatgaa
accaaatgcccaccctgttcgaatgtactctgcaatccttccgaaccacctctacccaga
agactaaataccactgccgagcaggtagcaagagaccacactcagcgctttatgaatgga
ggtgaggtgaaggtggaacagctgtttcaggaatttggcaaccgaagatccgatactctc
cagtcggatggcatcagcgactctgagaaatgctctcctaccgtttctcagggtaagagt
tcagatagctcaaatgcggtaaaacccagcagttcagccaaagcatccaaagtggtgcca
ctgactccagagcaagcgctgaagcagtataaacaccacctcactgcttatgagaagctg
gagatcgtcaactatccagaaatttacttcgtgggtccaaatgccaaaaagagacatgga
gtgatcggcggtcccaataacggggggtacgatgatgcagatggggcctatattcatgta
cctcgtgaccatctagcttatcgatatgaggtgctgaaaatcatcggcaaggggagtttt
gggcaagtcgcccgggtctacgatcacaaactccgacagtatgtggccctaaaaatggtg
cgcaatgaaaagcgcttccatcggcaggcagctgaggagatccggattttggagcatctc
aaaaagcaggacaaaactgggagcatgaacgtcatccacatgctggaaagtttcacattc
cggaatcatgtctgcatggccttcgaattgctgagcatagacctttatgagctaattaaa
aaaaacaagtttcaggggtttagcgtccagttagttcgcaagtttgctcaatccatcttg
caatccttggatgctctccacaaaaataagatcattcactgtgacctgaagccagaaaac
attctcctgaaacaccacgggcgcagtgcaaccaaggtcattgactttgggtccagctgc
ttcgaataccagaagctttacacctatatccagtctcggttctacagagctccggagatc
atcttaggaagccgctacagcacgcctatcgacatatggagttttggctgcatcctcgca
gaacttttaacaggacagcctctcttcccgggagaggatgagggggaccagctggcctgt
atgatggagctgctagggatgccaccaccaaaacttctggagcagtccaaacgtgccaag
tactttattaactccaagggcctacctcgctactgttctgtgactactcaggcagacggg
agagtcgtgcttgtggggggtcgctcacgtaggggtaaaaagcggggtccgccaggcagc
aaggactgggtgacagcactgaaggggtgtgatgactgcttgtttatagagtttttgaaa
aggtgtctccactgggacccctctgcccgtttgaccccggctcaagcactgagacatcct
tggattagtaagtctgtgcccagacctctgaccattgaaaaagtgtcgggtaaacgggtg
gtaaatcctgcaaatgctttccagggactgggttccaagctgcctccagttgtcggaata
gccaataagcttaaagctaacttgatgtcagaatccaacggtggtatacctctgtgcagt
gtattgcccaaactcattagctaa

DBGET integrated database retrieval system