KEGG   Felis catus (domestic cat): 101091131Help
Entry
101091131         CDS       T02385                                 

Gene name
HAT1
Definition
(RefSeq) histone acetyltransferase 1
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    101091131 (HAT1)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101091131 (HAT1)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101091131 (HAT1)
   HAT complexes
    HATB complex
     101091131 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
C1
AA seq 455 aa AA seqDB search
MPEVGGGNASDNELTSGQGARGLIRPSSAAGARSSEMAGFGAMEKFLVEYKSAVEKKLAE
YKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLS
TMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLH
TYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLV
FEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYY
IASPSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEEMAIEAQQKFKIN
KQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTN
QMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggtgggtgggggaaatgcgtcagacaacgagctcacttccggccagggagcg
cgcgggttgattcgtccttcctcagccgcgggtgctcgcagctcggaaatggcgggattt
ggtgctatggagaaatttttggttgagtacaagagtgcagtggagaagaagctggcagag
tacaaatgtaacaccaacacagcaattgaactaaaattagttcgttttcctgaagatctt
gagaatgacattagaactttctttcctgaatatacccatcaactctttggggatgatgaa
actgcttttggttacaagggtctgaagatcctgttatactatattgctggtagcctgtca
acaatgttccgtgttgaatatgcatctaaagttgatgagaactttgactgtgtagaggca
gacgatgttgagggcaaaattagacaaatcatcccacctggattttgtacaaacacaaat
gactttctctctttgctggaaaaagaagtcgatttcaagccgtttggaaccttacttcat
acatactctgttctcagtccaacaggaggggaaaactttacctttcagatatacaaggct
gacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatgtgg
tttattgaaactgctagctttattgacgtggatgatgaaagatggcactactttctagta
tttgagaagtataataaggatggagctacgctctttgcgaccgtaggctacatgacagtc
tataattactatgtgtacccagacaaaacccggccacgtgtaagtcagatgctgatactg
actccatttcaaggtcaaggccatggtgctcaacttcttgaaacagttcatagatactac
attgcatctccttctgttcttgatattacagcggaagatccatccaaaagttacgtgaaa
ttaagagactttgtgcttgtgaagctctgtcaagatttgccctgtttttcccgggaaaag
ttgatgcaaggattcaatgaagagatggcaatagaggcacaacagaagttcaaaataaat
aagcaacatgctagacgagtttatgaaattcttcgactactggtaactgacatgagtgat
gctgaacagtacagaagctatagactggacattaaaagaagactaattagcccatataag
aaaaagcagagagatcttgctaaaatgagaaaatgtctccgaccagaagaactgacaaac
cagatgaaccaaatagaaataagcatgcaacatgaacagctggaagaaagctttcaggaa
cttgtggaagattaccgacgtgtaattgaacgcctcgctcaagagtaa

DBGET integrated database retrieval system