KEGG   Felis catus (domestic cat): 101091131Help
Entry
101091131         CDS       T02385                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Alcoholism
Class
Human Diseases; Substance dependence; Alcoholism [PATH:fca05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 419 aa AA seqDB search
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYIASPSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SREKLMQGFNEEMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatttggtgctatggagaaatttttggttgagtacaagagtgcagtggagaag
aagctggcagagtacaaatgtaacaccaacacagcaattgaactaaaattagttcgtttt
cctgaagatcttgagaatgacattagaactttctttcctgaatatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggtctgaagatcctgttatactatattgct
ggtagcctgtcaacaatgttccgtgttgaatatgcatctaaagttgatgagaactttgac
tgtgtagaggcagacgatgttgagggcaaaattagacaaatcatcccacctggattttgt
acaaacacaaatgactttctctctttgctggaaaaagaagtcgatttcaagccgtttgga
accttacttcatacatactctgttctcagtccaacaggaggggaaaactttacctttcag
atatacaaggctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgatactgactccatttcaaggtcaaggccatggtgctcaacttcttgaaacagtt
catagatactacattgcatctccttctgttcttgatattacagcggaagatccatccaaa
agttacgtgaaattaagagactttgtgcttgtgaagctctgtcaagatttgccctgtttt
tcccgggaaaagttgatgcaaggattcaatgaagagatggcaatagaggcacaacagaag
ttcaaaataaataagcaacatgctagacgagtttatgaaattcttcgactactggtaact
gacatgagtgatgctgaacagtacagaagctatagactggacattaaaagaagactaatt
agcccatataagaaaaagcagagagatcttgctaaaatgagaaaatgtctccgaccagaa
gaactgacaaaccagatgaaccaaatagaaataagcatgcaacatgaacagctggaagaa
agctttcaggaacttgtggaagattaccgacgtgtaattgaacgcctcgctcaagagtaa

DBGET integrated database retrieval system