KEGG   Felis catus (domestic cat): 101091168Help
Entry
101091168         CDS       T02385                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E2
AA seq 261 aa AA seqDB search
MAFLWLLSCCALLGTAFGCGVPAIQPVLSGLSRIVNGEDAVPGSWPWQVSLQDSTGFHFC
GGSLISEDWVVTAAHCGVREALRXFGGAWDPGSALCQPLPSPXVFKNPKFNMFTINNDIT
LLKLATPARLSQTVSPVCLPNAKDSFPAGTLCATTGWGLTKHTNAQTPDRLQQAALPLLS
NTKCQKFWGSKITNLMVCAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSGTCSTSM
PGVYARVTKLMPWVQQILEAN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctctggctcctctcctgctgcgccctcctgggcacagccttcggctgcggg
gtccccgccatccaacctgtactgagtggcctgtccaggatcgtcaatggagaggacgct
gtcccgggctcctggccctggcaggtgtccctgcaggacagcaccggcttccacttctgc
gggggctccctcatcagtgaggactgggtggtcactgctgcccactgtggtgtcagagaa
gcactgaggtgatttgggggagcctgggaccctggttcagctctgtgtcagcctctgccc
tccccataggttttcaagaaccccaagttcaacatgttcaccatcaacaatgacattacc
ctgctgaagctggccacgcctgcccgcctctcccagactgtgtcccctgtgtgcctgccc
aatgccaaggacagctttcccgctgggaccttgtgtgcaaccacgggctggggcctgacc
aaacacaccaatgcccaaacccctgacaggctgcagcaggcggccctgcccctcctgtcc
aacaccaaatgccagaagttctggggcagcaagatcaccaatctcatggtctgcgctggg
gctagcggcgtttcctcctgcatgggcgactctggtggccccctggtctgccagaaggat
ggagcctggaccctggtgggcatcgtgtcctggggcagcggcacctgctccacctctatg
cccggcgtgtacgcccgcgtcaccaagctcatgccttgggtacagcagatcctggaagcc
aactga

DBGET integrated database retrieval system