KEGG   Felis catus (domestic cat): 101091172Help
Entry
101091172         CDS       T02385                                 

Gene name
RASGRF2
Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 2 isoform X1
  KO
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101091172 (RASGRF2)
   04010 MAPK signaling pathway
    101091172 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
A1
AA seq 1254 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRAGVGPAGARDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRIMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLAKLSDIYKRPFTSIPVRSLELFFATSQNSRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTTTHSPAASPP
PHTGKVPLDLSRGLPSPEQSPGSVEEHVDNPRVDLCNKLKRSIQRAVLESAPVDRAGVES
SPVADSSELSPCRSPSTPQHLRYRQPVGQTADNSHCSVSPASAFAIATAAAGHGSPPGNG
VIVYPAAEAPNSGFNNTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNV
LNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLSA
MELAEQITLLDHIIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMN
YADISSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALM
DKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMR
MISHIIREIRQFQQTCYRIDHQSKVTQYLLDKALIIDEDTLYELSLKIEPRLPA
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggccttcctggcccga
aaggagggcaccaagcgcggcttcctgagcaagaaggcagccgaggcgagtcgctggcac
gagaagtggttcgctctctaccagaatgtgctcttctacttcgagggcgagcagagcggc
cgccctgcgggcatgtatctcctggagggctgcagctgcgagcggacgcccgcgccgccc
agggccggggtcgggccggccggcgcccgggacgcgctggacaagcagtattactttacc
gttctttttggccatgaaggtcagaaacccctggagttgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcatcaagccagttatgcagacattttgattgagaga
gaagtgttaatgcagaagtacattcatctagttcagatcgtggagacggaaaaaattgca
gctaaccaactccggcatcaacttgaagatcaagatacagaaattgaaagacttaaatca
gagattatcgctcttaataaaaccaaggaacgaatgaggccttaccaaagtaatcaagag
gatgaggatccagatatcaagaagattaaaaaggttcagagcttcatgagaggatggttg
tgtagaaggaaatggaagaccattgtgcaggattacatttgttctcctcatgctgaaagc
atgaggaagagaaaccagattgtgttcaccatggttgaagctgagtcggagtatgttcac
cagctctacatcctggtcaatggcttcctccggcccctgcgaatggcggccagctccaag
aagcctcccatcagccatgatgatgtcagcagcatttttctcaacagtgaaacaattatg
tttcttcatgaaatatttcatcaaggactgaaggcaaggatagcaaactggcctacctta
attttagctgatctgtttgatattttgctccccatgttgaacatttatcaagaatttgtg
cgtaatcaccagtacagcctccaagtgcttgccaattgtaagcaaaaccgagatttcgac
aaactcttaaaacagtacgaagccaaccctgcgtgtgaggggaggatgctggaaacattc
ttgacctatccaatgttccagatccccaggtatatcatcacacttcacgaactcctagct
catacaccccatgagcatgtggaaaggaaaagtctggagtttgctaagtcaaaactagag
gaactgtccaggataatgcatgatgaagtgagtgacactgaaaacataaggaagaacctt
gccatagaaagaatgatcgtagagggttgtgatattttgctggacaccagccaaactttt
atccgccaaggttctcttattcaagtaccttctgttgagagggggaaacttagtaaagtt
cgcctgggttcactgtctttgaaaaaggaaggagaaagacagtgcttcttatttacaaaa
cactttttaatttgtacaagaagttcaggaggaaagctgcatctgctcaagacaggtggg
gttctctctctaatagaatgtactttgattgaggagcccgatgcaagtgatgatgactcc
aaaggttctggacaagtgtttggacatctagattttaaaatagtagtggagcctcctgat
gctgccccattcactgtagtcctgttggcaccttcacgtcaggagaaagctgcctggacg
agtgacataagtcagtgtgtggacaatatacggtgtaatggtttaatgactatagtattt
gaagagaattccaaagttactgtgccacatatgattaagtctgatgcccgtcttcataaa
gatgacaccgacatttgctttagtaaaacactcaactcctgcaaagtgccccagatccgc
tatgccagcgtggagcgccttctggagcggctgacagacttgcggtttcttagtattgat
ttcctcaatacctttctgcacacctatcgtattttcactacggcagctgtggtgctggcg
aaactttccgacatatacaagaggccttttacctccatccccgtcaggtcattagaattg
ttttttgctaccagccagaacagtagaggtgaacatttggtagatggcaaatccccacgc
ctgtgtcgcaaattctcttccccaccaccactggctgtgtccaggacgtcctccccagtg
agggccagaaagctgtccttgacttctccattgaactcaaggataggagcattggacctg
accacctgctcagcgtccagcagccctaccaccacccacagccctgctgcatccccaccg
ccgcacactggtaaagtaccgttggatcttagcagaggccttccttctccagaacaaagc
ccgggatctgtagaagagcatgtagataatccccgcgtggatctgtgtaacaagctaaaa
cgaagtattcaaagagctgtcctagagtctgcaccagtggaccgagcaggagtggaaagc
tccccggtggcggacagctcagaactttcaccttgccggtcaccctcaactcctcagcac
ctccgctatcgtcagcctgtaggacagacggctgacaactctcactgctcggtttcgcct
gcttctgcttttgcaattgccacagcggctgcaggacacgggagtccaccaggaaatggc
gtcattgtctacccagctgcggaggccccaaacagcggattcaacaacactgagagaaca
tgcgacaaagagtttattattcggagaacagccaccaatcgagtactgaatgtcctccgt
cactgggtctcaaagcacgcgcaggattttgagctcaacaacgaactaaaaatgaatgtc
ctaaatttgctagaagaagttttgcgagacccagaccttcttccccaagaaaggaaagcc
acggcgaatattctgagggccctttcacaagatgatcaagatgacatccacctaaaatta
gaggatataattcaactgacagactgtccgaaggctgagtgctttgagaccttgtcagcc
atggagctggctgagcagatcaccctcctggaccacatcattttcagaagcattccctac
gaagaatttcttgggcaggggtggatgaagctggataaaaatgaaagaacaccttacatt
atgaaaaccagccagcacttcaatgatatgagcaacctggtggcctcccagataatgaat
tatgccgatatcagctcccgtgccaacgcaatagagaagtgggtggcagtggcggacatt
tgccgatgcctgcacaactacaatggcgtgctggagatcacctcggccttaaaccgaagt
gccatctataggctgaagaaaacctgggccaaggtgtccaagcagacaaaagctctaatg
gacaaacttcagaagactgtttcatctgaaggaagatttaaaaatctcagagaaaccctt
aaaaactgtaaccccccagctgttccttatctggggatgtacctgacagacctagcattt
attgaagaaggaacaccaaactttaccgaggaaggccttgtcaatttctccaaaatgaga
atgatatcacacatcatcagagagatacgccagttccagcagacttgctatcgaatagac
catcagtcaaaggtgactcagtacctgcttgacaaagccctcatcatagatgaagatacg
ctgtatgaactgtcactaaaaattgaacctcggctccctgcttga

DBGET integrated database retrieval system