KEGG   Felis catus (domestic cat): 101091184Help
Entry
101091184         CDS       T02385                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101091184 (AURKA)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101091184 (AURKA)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   101091184 (AURKA)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101091184 (AURKA)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101091184 (AURKA)
   Spindle formation proteins
    101091184 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    101091184 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
A3
AA seq 405 aa AA seqDB search
MDKSKENCVAGPVKTTIPLGDGPKRVPVTQQFPSQNLLSANSGQAQRVLCPSNSSQRIPS
QTQKLVSSHKPVQNLKQKQLQATSVPRSVSRPLNNTQKSEQPLPSATGNNSEKELTTKQK
NEESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITE
LADALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPE
MIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEASTYQETYKRISRVEFTFPDFVPEGARDL
ISRLLKHNPSQRPTLKEVLEHPWVTANSSKPSGSQKSKESTGKQS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatctaaagaaaactgcgttgcagggcctgttaagaccacaattccccttggc
gatggtccaaaacgtgttccagtgactcagcaatttccttctcagaatctgttatctgca
aatagtggccaggctcagcgggtcttgtgtccttcaaattcctcccagcgaattccttca
caaacacaaaagctcgtctccagccataaaccggtccagaatctgaagcaaaagcaactg
caggcaaccagtgtccctcgttctgtctctaggccgctgaataatacccaaaagagtgag
cagcccttgccatcggccactggaaataattctgaaaaggaactgacaacaaaacagaaa
aatgaagaatcaaaaaaaaggcagtgggctttggaagattttgaaatcggtcgcccgctg
ggtaaaggaaagtttggtaatgtttatttggcgagagaaaaacaaagcaagtttatcctg
gctcttaaagtattatttaaagctcagctggagaaagcaggagtcgagcatcagctgaga
agagaagtagaaatacagtcccaccttaggcatccaaatattctcagattgtatggttat
ttccacgacgccaccagagtttacctaattctagaatatgcacctcttggagctgtctac
cgagaacttcagaaactgtctaagtttgatgagcagagaactgctacttatatcacggag
ttggcagatgccctgtcttattgtcactcaaagagagtcattcatagagacattaagcca
gagaacctgctcctcggttcagctggagagcttaagattgcggattttggatggtcggta
cacgccccatcctccaggagaaccaccctctgtggcaccttggactacttgcccccagag
atgattgaaggccgaatgcacgacgagaaggtggatctctggagccttggggtactctgc
tatgaatttctagttgggaagcctccatttgaggcgagcacataccaagagacttacaag
agaatatcgcgggttgaattcacattccctgactttgtaccggagggagccagggacctc
atctcaagactgttgaaacataatcccagccaaagaccgactctcaaagaagtacttgaa
cacccttgggtcacggcaaattcatcaaaaccatcaggtagccaaaaaagcaaagaatca
actggcaaacaatcttaa

DBGET integrated database retrieval system