KEGG   Felis catus (domestic cat): 101091213Help
Entry
101091213         CDS       T02385                                 

Gene name
SMUG1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
fca  Felis catus (domestic cat)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    101091213 (SMUG1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     101091213 (SMUG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B4
AA seq 272 aa AA seqDB search
MALPQAYPLGPLHEPASALMEPQPCPQNLAEGFLEEELRLSSELSQLRFSEPVGIIYNPV
EYAWEPHRSYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGIGGHVLTPP
QEHPKRPVLGLECPQSEVSGARFWGLFRKLCGQPEVFFRHCFVHNLCPLLFLTPSGRNVT
PAELPAEQREQLLGACDAALRQQVQLLGVRLVVGVGRLAEQRARRALAGLMPVVRVEGLL
HPSPRSPQANRGWEAVAKERLNELGLLPLLMK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctttgccccaggcttatccactggggcccctccatgaacctgcgagtgccctaatg
gagccccagccttgccctcaaaacttggctgaaggcttcctggaggaggagcttcggctc
agctctgaactgagccagctgcggttctcagagcccgtgggcatcatctacaatcctgtg
gagtatgcgtgggagccacaccgtagctatgtgacccgctactgccagggccccaaggaa
gtgctgttcctgggcatgaacccaggaccctttggcatggcccagactggggtgcccttt
ggggaagtgaacgtagtccgggactggttgggcatcggggggcatgtgttgacccctccc
caagagcaccctaaacgaccagtgctgggactggagtgccctcagtcagaggtgagcggt
gcccggttctggggccttttccggaaactgtgtggacagcctgaagtcttcttccgtcac
tgttttgtccacaatctgtgtcctctgctcttcctgacccccagtgggcgcaacgtcact
cccgctgagctacctgccgagcagcgagaacagcttcttggagcctgtgacgcggccctc
cgccagcaggtgcagctgctgggggtgcggctggtggtgggagtggggcggctggcagag
cagcgggcacggcgggctctggcaggcctgatgcctgtggtccgggtggaggggctcctg
cacccctcacctcgtagccctcaagccaacaggggctgggaggctgtggccaaggagaga
ctgaatgagctggggctgctgccgctgctaatgaaatga

DBGET integrated database retrieval system