KEGG   Felis catus (domestic cat): 101091234Help
Entry
101091234         CDS       T02385                                 

Gene name
CDC27
Definition
cell division cycle protein 27 homolog-like
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
fca  Felis catus (domestic cat)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101091234 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101091234 (CDC27)
   04114 Oocyte meiosis
    101091234 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101091234 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    101091234 (CDC27)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101091234 (CDC27)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     101091234 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 825 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSNCL
PSSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNLNDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCREAIYILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcagtttttcttgcagaacgactgtatgcagaagtacactcagaggaagcc
ttgtttttattggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccgcagtgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatctttacagaactttagcaactgtctg
cccagctcttgcacaacactagtatctaatcatagtttatctcatagacaacccgagacc
gttcttacagaaacaccccaggacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagcttattaggaggaccagctgctcttagtccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccatctactggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagcggaaatagtcga
gaggtaactccaattcttgttgcacaaacacaaagttctggcccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcactgcctcgaagaagttcg
cgactctttactagtgacagctctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatcccaaacagaaaaactaaaagtaaaactaacaaaggaggaataact
caacctaacttaaatgatagcctggaaattacaaaattggactcttccatcatttcagaa
gggaaaatctccacaatcacacctcagatccaggcatttaatctgcagaaagcagcagca
gaaggtttgatgagccttcttcgtgaaatggggaaaggttatttagctctgtgctcgtac
aactgcagagaagctatatatatcttgagccacctaccttctcaccactacaatactggt
tgggtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaggctgaa
agaatattctccgaggttagaaggattgagaattacagagtcgaaggcatggagatctac
tctacaacactttggcatcttcagaaagatgttgctctttcagttctttcaaaagactta
acagacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttg
caacgggagcatgatattgcaattaaattcttccagagagctatccaggttgatccaaat
tatgcttatgcctatactctactagggcacgagtttgtgttaactgaagaattagacaaa
gcattagcttgttttcgaaatgctatcagagtcaatccgagacattacaatgcatggtat
ggcttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccag
aaagcacttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcag
catgcactgaaaaaatctgagaaggctttggataccctaaacaaagccattgttattgat
cccaagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatat
aagtctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtt
tacttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaatt
gacaagcgctaccttccagatgatgaggagccaataacccaagaagaacaaatcatggga
acagatgaatcccaggagagcagcatgacagacgcagacgacacacaacttcatgcagct
gaaagcgatgagttttaa

DBGET integrated database retrieval system