KEGG   Felis catus (domestic cat): 101091299Help
Entry
101091299         CDS       T02385                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X3
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04380  Osteoclast differentiation
fca04612  Antigen processing and presentation
fca04668  TNF signaling pathway
fca04710  Circadian rhythm
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04725  Cholinergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04931  Insulin resistance
fca04934  Cushing's syndrome
fca04962  Vasopressin-regulated water reabsorption
fca05016  Huntington's disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05165  Human papillomavirus infection
fca05166  HTLV-I infection
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05203  Viral carcinogenesis
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    101091299 (CREB1)
   04024 cAMP signaling pathway
    101091299 (CREB1)
   04022 cGMP - PKG signaling pathway
    101091299 (CREB1)
   04151 PI3K-Akt signaling pathway
    101091299 (CREB1)
   04152 AMPK signaling pathway
    101091299 (CREB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    101091299 (CREB1)
  Endocrine system
   04911 Insulin secretion
    101091299 (CREB1)
   04922 Glucagon signaling pathway
    101091299 (CREB1)
   04915 Estrogen signaling pathway
    101091299 (CREB1)
   04926 Relaxin signaling pathway
    101091299 (CREB1)
   04918 Thyroid hormone synthesis
    101091299 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    101091299 (CREB1)
   04916 Melanogenesis
    101091299 (CREB1)
   04924 Renin secretion
    101091299 (CREB1)
   04925 Aldosterone synthesis and secretion
    101091299 (CREB1)
   04927 Cortisol synthesis and secretion
    101091299 (CREB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101091299 (CREB1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    101091299 (CREB1)
  Nervous system
   04725 Cholinergic synapse
    101091299 (CREB1)
   04728 Dopaminergic synapse
    101091299 (CREB1)
  Development
   04380 Osteoclast differentiation
    101091299 (CREB1)
  Aging
   04211 Longevity regulating pathway - mammal
    101091299 (CREB1)
  Environmental adaptation
   04710 Circadian rhythm
    101091299 (CREB1)
   04713 Circadian entrainment
    101091299 (CREB1)
   04714 Thermogenesis
    101091299 (CREB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101091299 (CREB1)
   05215 Prostate cancer
    101091299 (CREB1)
  Neurodegenerative diseases
   05016 Huntington's disease
    101091299 (CREB1)
  Substance dependence
   05030 Cocaine addiction
    101091299 (CREB1)
   05031 Amphetamine addiction
    101091299 (CREB1)
   05034 Alcoholism
    101091299 (CREB1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101091299 (CREB1)
   04934 Cushing's syndrome
    101091299 (CREB1)
  Infectious diseases
   05152 Tuberculosis
    101091299 (CREB1)
   05166 HTLV-I infection
    101091299 (CREB1)
   05161 Hepatitis B
    101091299 (CREB1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101091299 (CREB1)
   05165 Human papillomavirus infection
    101091299 (CREB1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    101091299 (CREB1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    101091299 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 DUF4988
Motif
Other DBs
NCBI-GeneID: 101091299
NCBI-ProteinID: XP_019694098
Ensembl: ENSFCAG00000008220
Position
C1
AA seq 111 aa AA seqDB search
MSVNLNSERQFEDAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRL
MKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgaatttgaattctgaacgtcagtttgaagatgctgcctctggagatgtacag
acgtaccagattcgcacagcacccactagcaccattgcccccggagttgttatggcatcc
tccccagcacttcctacacagcctgctgaagaagcagcacgaaagagagaggttcgcctc
atgaagaacagggaagcagcacgagagtgtcgtagaaagaagaaagaatatgtgaaatgt
ttagaaaacagagtggcagtgcttgaaaaccaaaataagactctcattgaggagctaaaa
gcacttaaggacctttactgccacaaatcagattaa

DBGET integrated database retrieval system