KEGG   Felis catus (domestic cat): 101091308Help
Entry
101091308         CDS       T02385                                 

Gene name
POLD4
Definition
(RefSeq) polymerase (DNA-directed), delta 4, accessory subunit
  KO
K03505  
DNA polymerase delta subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101091308 (POLD4)
   00240 Pyrimidine metabolism
    101091308 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    101091308 (POLD4)
   03410 Base excision repair
    101091308 (POLD4)
   03420 Nucleotide excision repair
    101091308 (POLD4)
   03430 Mismatch repair
    101091308 (POLD4)
   03440 Homologous recombination
    101091308 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    101091308 (POLD4)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101091308 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 107 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPLSVDEAELELLRQFDLAWQYGP
CTGITRLQRWHRAEQMGLEPPAEVRQVLQTHPGDPRFQYSLWHVYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgactcctaccctgtagtgaagaggagggagggcccc
gctgggcacagcaagggggagctggcgccagagctaggggaagagccccagcctctgagc
gtggatgaagcagagctggagctgctgaggcagtttgatctggcctggcaatatgggccc
tgcacagggatcacgcggctgcagcgctggcatcgggccgagcagatgggcttggagccc
cccgctgaagtgcgccaggtgctgcagacccaccctggagatccccgcttccagtacagc
ctctggcacgtctatcccctttga

DBGET integrated database retrieval system