KEGG   Felis catus (domestic cat): 101091322Help
Entry
101091322         CDS       T02385                                 

Gene name
KMT5C
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101091322 (KMT5C)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101091322 (KMT5C)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101091322 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
E2
AA seq 387 aa AA seqDB search
MRLETETLAKSCAAHKRPFPGRRPCPCIVPPTLGQRQHGPRGTMGPDRVTARELCENDDL
ATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLKQRDLEAAYRALTLGGWMAHY
FQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLEL
LVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGN
AACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEGAFRLRPREPAPPRLLDK
YELRETKRRLQQGLEGGGRLGPRACAHLSPLLRDPFCGELGAGTLSCQPVSIPTTDGNAA
CVKVLRDIEPGDEVTCFYGEGFFGEKE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagactggagaccgaaacgcttgccaaatcctgcgcagctcacaaacggcccttcccg
gggcgccgcccctgcccctgcattgtgcccccgactcttggccagaggcagcatggtccg
cggggcaccatgggacctgacagagtgacagccagagagctgtgtgagaatgacgacctt
gccaccagccttgtcctggacccctacctcggcttccgcacccataagatgaacgtcagc
cccgtgccccccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaag
cagcgggacctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactac
ttccagagccggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctc
cgagccttcctgcctgaaagcggctttaccatcctgccctgtacacgctattctatggag
acaaatggagccaagattgtgtctaccagagcttggaagaagaacgagaagctagaactg
ctggtgggctgcatcgcggagctgcgggaggctgacgaggggctgctgagggccggcgag
aacgacttcagcatcatgtactccacccgcaagcgcagcgcacagctgtggctgggcccc
gccgccttcataaaccacgactgcaaacccaactgcaagtttgtgcccgcagatgggaac
gcagcctgtgtgaaggtactccgggacattgagccgggggacgaggtaacctgcttctat
ggcgaaggcttctttggtgaaaagaatgagcactgtgaatgctatacctgtgagaggaga
ggcgaaggggccttccgactgcggcccagggaacccgcgcccccgcggctgctggacaag
tacgagctccgggagaccaagcggaggctgcagcagggcctggagggtggtggccggctg
ggccccagggcctgcgcccacctgtccccactactccgggacccgttctgtggtgagctc
ggggcggggaccctgtcctgccagcctgtgtccatcccgaccaccgatgggaacgcagcc
tgtgtgaaggtactccgggacattgagccgggggacgaggtaacctgcttctatggcgaa
ggcttctttggtgaaaaagaatga

DBGET integrated database retrieval system