KEGG   Felis catus (domestic cat): 101091353Help
Entry
101091353         CDS       T02385                                 

Gene name
USP13
Definition
(RefSeq) ubiquitin specific peptidase 13 (isopeptidase T-3)
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101091353 (USP13)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101091353 (USP13)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101091353 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
C2
AA seq 798 aa AA seqDB search
MNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDD
LNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENE
LPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSGGNGHA
LEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHGTENGL
RDNDIKPRVSEWEVIQETGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEFQRAYV
GNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQQNGIS
PRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQ
TRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIPFSACL
QAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFDVSIDM
PDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQLAEMG
FPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGATGLD
NQPPEEIVAIITSMGFHRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEMENNAN
ANIISEAKPEGPRVKDGSGMYELFAFISHMGTSTMSGHYVCHIKKEGRWVIYNDHRVCAS
ERPPKDLGYMYFYHRVPR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatttttggcctttggaagggaacatgttgaaagacattttcgaaaaactgga
cagagtgtgtacatgcacctgaaaagacatgtgcgagagaaggtaagaggggcatctggt
ggagctttaccaaaaaggaggaattccaagatttttttagatctagatactgatgacgat
ttaaatagcgacgattatgaatatgaagatgaagccaaacttgttatattcccagaccac
tatgaaatagcactaccaaatattgaggagttaccagccctggtaacaattgcttgtgat
gcagttctcagctcaaaatctccatatagaaagcaggacccagacacgtgggaaaatgaa
ttgccagtatccaaatatgccaataaccttacccagttggacaatggagtcaggattcct
ccaagtggttggaagtgtgccaggtgtgaccttcgggaaaacctctggttgaatctgacc
gatggctccgtgctgtgtgggaaatggttctttgacagctccgggggcaatggccacgcg
ctggagcattacagagacatgggctaccctctggctgtgaaactgggaaccatcactcct
gacggggcagatgtttattcttttcaagaagaggaacctgttttggatcctcatttggcc
aagcacttagcgcattttggaattgatatgcttcatatgcacgggacagagaacgggctt
cgggacaatgacatcaagccgcgggtcagcgagtgggaagtgatccaggagacggggacg
aagctgaagcccatgtatggccccgggtacacgggtctcaagaacctgggcaacagctgc
tatctcagttcggtcatgcaggccatcttcagcatcccagaattccagagagcgtatgtg
ggaaatcttccaagaatatttgactactctcctttagatccaacacaggatttcaacaca
cagatgactaagttaggacacggccttctctcaggccagtattcaaagcctccagtgaaa
tctgaactcattgaacaggtgatgaaggaagaacacaagcctcaacagaatgggatctct
ccacgcatgtttaaggccttcgtaagcaagagccacccggaattctcctctaatagacag
caggatgcccaggagttcttcttgcacctggtgaatctagtagagaggaaccgcattggc
tcagaaaacccaagtgatgtttttcggtttttggtggaagaacgtattcagtgctgtcag
acccggaaagtccgctacacggagagggtggattacctgatgcagttacctgtggccatg
gaggcagcaaccaacaaggatgaactgattgcctatgaattaacgagaagggaagcagaa
gcaaacagaagaccccttcctgagttggttcgcgccaagataccatttagtgcctgcctt
caggccttttctgaaccagaaaatgtcgatgacttctggagcagcgccctacaagcaaag
tctgcgggtgttaaaacatctcgctttgcctcattccctgaatacttggtagtgcagata
aagaagttcacttttggtcttgactgggttcccaaaaaatttgatgtttctattgacatg
ccagacctacttgatatcaaccatctccgagccagggggttacagccaggagaggaggaa
cttccggacatcagcccccctatcgtcattcctgatgactcaaaagatcgcctgatgaac
caactgatagacccctcagacattgatgagtcatcagtgatgcaactggccgagatgggt
ttccctctagaagcgtgtcggaaggctgtgtactttactggaaatatgggagctgaagtg
gccttcaactggatcattgttcacatggaagagccagattttgccgaaccactgaccatg
cctggttatggaggagcggcttctgctggggcctctgtttttggtgctactggattggat
aaccaacctccggaggaaattgtagctatcattacttccatgggattccatcggaatcag
gctattcaggcgctacgagccacgaataataacctggaaagagccctggattggatcttt
agtcaccctgagtttgaggaggacagtgactttgtgatcgagatggagaataacgccaat
gcaaacattatttctgaggccaagcctgaaggacctagagtcaaggatggatctggaatg
tatgaattatttgcgttcatcagtcacatgggaacatctacaatgagtggccattatgtt
tgccatattaaaaaggaaggaagatgggtgatctacaatgaccacagggtgtgtgcctca
gaaaggccccctaaggacctgggctacatgtacttttaccacagggtaccacgctga

DBGET integrated database retrieval system