KEGG   Felis catus (domestic cat): 101091428Help
Entry
101091428         CDS       T02385                                 

Gene name
GLA
Definition
galactosidase, alpha
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
fca  Felis catus (domestic cat)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fca00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fca00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fca00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:fca00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:fca04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 483 aa AA seqDB search
MKLENGIQQPGFLLALRFLALVLWSFPGARALDNGLAMTPTMGWLHWERFMCNVDCQEEP
DSCISEKLFMQMAELMDSDGWKDVGYEYLCIDDCWMAPKRDSKGRLQADPKRFPGGIQGL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCHCDSMEHL
ENGYKHMSLALNRTGRSIVYSCEWPLYMWPFRKPNYTEIRQYCNHWRNFDDVYDSWQSIK
NILDWTSSNQKRIIDVAGPGGWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYRLRKEDNIEVWERPLSDLAWAVAMVNLQEIG
GPRFYTISIASLGQGMACIPDCIITQLLPVKRKLGFYQWTSDLKIQINPTGTVLLRLAAN
XTTLQSFLLNVYLVAKGTTPLVSPFSSIPTSAIISLNKIFQWSLRTSKCIFREHFVKKLL
NKC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggagaacggaattcagcagccgggcttcctgctggcgcttcgcttcctggcc
ctggttctctggagcttccctggggccagggccctggacaatggcttggcgatgaccccc
accatgggctggctgcactgggagcgcttcatgtgcaatgttgattgccaagaagagcca
gattcttgtatcagcgagaagctcttcatgcagatggcagaactcatggactcagatggg
tggaaggatgtaggttatgagtacctctgtattgatgactgttggatggctcccaaaaga
gattcaaaaggcagacttcaggcagaccctaaacgctttcctggtgggatccaaggcctt
gctaattatgtccatagcaaaggactgaagctcggaatttatgcagatgttggaaataaa
acctgtgcaggctttcctgggagttttggatactatgacattgatgcccagacctttgct
gactggggagtagatctactaaaatttgatggttgtcactgtgacagcatggaacatttg
gaaaatggttataagcacatgtccttggccctgaacaggactggcagaagcattgtgtat
tcctgtgagtggcccctttatatgtggccttttcgtaagcccaattacacagaaatccga
cagtactgcaatcactggagaaattttgatgatgtttatgattcttggcaaagtataaag
aatatcttagactggacatcttctaaccagaagagaattatcgatgtcgcaggaccaggg
ggttggaatgacccagatatgttagtgatcggtaactttggccttagctgggatcagcag
gtaactcagatggccctgtgggctatcatggcagctccattactcatgtccaatgacctc
cgacacatcagccctcaggccaaagccctccttcaggataaggatgtaattgccatcaat
caagaccccttaggcaagcaggggtaccggcttagaaaggaagacaacattgaagtgtgg
gaacgcccactatcagatttagcttgggctgtggcaatggtaaacctgcaggagatcggt
ggacctcgtttctataccatctctattgcttccctgggacaagggatggcctgtattcct
gactgcataatcacacagctcctgcctgtgaagagaaaacttgggttttatcagtggact
tcagatttaaaaattcagataaatcccacaggcacggttttacttcggctggcagcaaat
tagaccacattacaaagctttcttttaaatgtgtatcttgttgccaaagggactacccca
ttggtgtctcctttttcttccattcccacttcagccatcatttccttgaataaaattttc
cagtggagtttaagaacttccaaatgtatctttagagaacattttgtgaaaaagcttttg
aacaaatgttaa

DBGET integrated database retrieval system