KEGG   Felis catus (domestic cat): 101091432Help
Entry
101091432         CDS       T02385                                 

Gene name
ALDH1L1
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L1
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
fca  Felis catus (domestic cat)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101091432 (ALDH1L1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101091432 (ALDH1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 1051 aa AA seqDB search
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKIPRWR
VKGQALPDVVAKYQALGAELNVLPFCSQFIPMEVINAPCHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEILPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKINWEQSAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTAGLVPEGEALPIPGAHQPGIVTKAGLILFGNDDRMLLVKNIQLEDGRMI
PASRFFSGADSSVLELTEAELVMAETVRSAWKRILPSVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFGDFIQLLVKKLRGDNKESECIIDYVEKVVNKLTLRM
PHQLFIGGLFVDAEGAKTYETINPTDGSVICQVSLAQVSDVDKAVAAAKDAFENGLWGKI
SARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTRKEPIGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNILPGSGKRCGQGHLEVTGLQEVRDALGQNRACCMMC
SSREDCDFSVHENLIGDLYQLSDIHPGKAFQLLEFSSDIWGSLCPKGGTWVGLTSLGPRP
YWFRCWVQVLTYQLSLSPVGTRERGQPEATEKETAEIQSGHTFSLAIPRSVTASPFSQTG
GNNGPAWLRLPGVQLCSHGWDRDLTAEARGPGSATRLQPWKTGASDDGPMSVSESHRVVP
EPLGSEFSRETALSLGLQVMVPFMFAGTGLSGAGVLLNYFQERHPQHVVFTTQVSQIAVP
EWECVHGGQQDQVWPGIGPPTYTPRTSVSPLGFFFEPTVFTDVEDHMFIAKEESFGPIMI
ISRFADGDVDTVLSRANATEFGLASGVFTRDINKALYVSDKLGAGTVFVNTYNKTDVAAP
FGGFKQSGFGKDLGEEALNEYLRVKTITFEY
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccgtgattgggcagagcctgtttggccaggaagtttactgtcacctgcgg
aaggagggacatgaggtcgtgggtgttttcactgtcccagacaaggatggaaaggcagat
cccctgggcctggaggccgagaaggatggagtgccagtgttcaagatcccccgctggcgg
gtgaaaggacaggctctgcccgatgtggtggcgaaataccaggctttgggtgctgagctc
aacgtcctgcccttctgcagccagttcatccccatggaggtcatcaatgccccctgtcat
ggctccatcatctaccacccaagtctgctcccccgacaccgaggggcctcggccatcaac
tggacccttattcatggagacaagaaagggggttttaccatcttctgggcagatgacggt
ctggacactggggaccttcttctccagaaggagtgtgagatcctcccggatgacaccgtg
agcactctatacaaccgcttcctctttcctgaaggcatcaaagggatggtgcaggctgtg
aggctgatcgccgaaggcaaagcccccagactcccccagcctgaggaaggagccacctac
gagggtattcagaagaaggaaacagccaagatcaactgggagcagtcagcagaggcgatt
cataactggatccgagggaacgacaaggtgccaggcgcctggacagaggcctgtgggcag
aagctgactttcttcaactcaacgctaaacactgcaggcctggtgcctgagggagaagcc
ttgcctatcccaggagctcatcagccggggatagtcaccaaagcgggactcatccttttc
gggaatgatgacagaatgcttctggtgaagaacatccagctggaggatggcaggatgatc
ccagcctcacgcttcttcagcggagcagacagcagtgtccttgagctgacagaggcagaa
ctggtcatggcagagactgtgcggagtgcctggaaacggattctccccagtgtcctagag
gtggaagactccactgatttctttaagtcaggggctgcatcagtggatgttgtgagactg
gttgaggaagtgaaggagctgtgtgatggactggaattagaaaatgaagatgtttacatg
gcaaccacctttggggacttcatccaactattagtgaagaagctacgaggggacaacaaa
gagagcgagtgcatcattgactatgtggaaaaggtggtgaacaagctcaccctccgaatg
ccccaccaactcttcattgggggactgtttgtggatgctgagggtgccaagacctatgag
accatcaacccaacagacggaagtgtcatctgccaggtgtccctggcccaggttagcgat
gttgacaaggcagtggctgccgctaaggatgcctttgagaatggattgtgggggaagatc
agtgcacgggatcgaggccggctcctgtacaggttggcagacctcatggaacagcaccag
gaagagctggccaccatcgaggctctggatgcaggcgctgtctacacactggccctgaag
acccacgtgggcatgtccatccagaccttccgctactttgctggctggtgtgacaaaatt
cagggctccaccatccccatcaaccaagccagaccaaaccgcaacctgaccttgaccagg
aaggagcctattggggtctgtggcatcgtcatcccctggaactaccccctgatgatgctc
tcctggaagacggctgcctgcctggctgctgggaacacagtggtgatcaagcctgcccag
gtgactccactcacagccttgaagtttgcagagttgaccttgaaggctggcattcccaag
ggcgtggtcaatatcctccctgggtctggtaagagatgtggacaggggcatctggaggtg
acagggctccaggaagtcagagatgcacttggtcagaacagggcttgctgcatgatgtgc
tctagtagggaagactgtgacttctctgttcatgaaaaccttattggcgacctctatcaa
ctgagtgatattcatcctggcaaagccttccaacttctggagttttcttctgatatctgg
ggaagcctgtgccccaaaggaggcacttgggtgggcctgacttctttggggccccggcct
tactggttccgatgttgggtccaagtcctcacctaccagttgtctttgagtccagtggga
acaagggagcggggccagcccgaggcaaccgagaaggagactgccgaaatccagtcaggg
cacaccttctcccttgcaatccctcgctctgtcaccgcctcgccgttctcccaaacaggt
ggcaacaatgggccagcatggttaaggctgccaggggttcagctctgctcacatggatgg
gacagagatttgacagcagaggccagaggacctggctctgccacacgccttcagccctgg
aagactggagcctcagatgatggacctatgagtgtgtctgagagccacagggtggtccct
gaaccactggggtctgagttcagcagggagactgccttgtcccttggccttcaggtgatg
gtgcccttcatgtttgcaggaacgggactgtccggggctggtgtgcttttgaactatttc
caggaaaggcacccacagcatgtggtcttcaccacacaggtgtcacaaattgcagtgcca
gagtgggaatgtgtgcatggtggccaacaggaccaggtctggcctgggataggaccaccc
acctacacaccacggacctctgtctcccccttaggtttcttcttcgagccaactgttttc
acggatgtggaggaccacatgttcatagccaaggaggagtcctttgggcccatcatgatc
atctctcggtttgctgatggtgacgtggacaccgtgctgtctcgggccaatgcgacagaa
tttggcctggcttctggcgtcttcaccagggacatcaacaaggccctgtatgttagcgac
aagctgggggcaggcaccgtgtttgtcaacacatacaacaagaccgacgtggccgctccc
ttcggagggttcaagcagtccggctttggcaaagaccttggagaggaggccctgaacgag
tacctgcgggtcaagacaattacttttgagtactga

DBGET integrated database retrieval system