KEGG   Felis catus (domestic cat): 101091450Help
Entry
101091450         CDS       T02385                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
fca  Felis catus (domestic cat)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    101091450 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    101091450 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101091450 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101091450 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    101091450 (TPM1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101091450 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B3
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgccttggat
cgagccgagcaggcggaggccgataagaaggcggcggaggacaggagcaagcagctggaa
gatgagctggtgtcgctgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaagttggagctggcggagaaaaaggccactgac
gctgaagccgatgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgactggcaacagctttgcagaagctggaggaggccgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgaaagtcgagcccaaaaggatgaggagaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aagtatgaagaggtggcccgtaagctggtcatcattgagagtgacctggaacgtgcggag
gagcgggctgagctctcagaaagcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tacgaggaagagatcaaggtcctttctgacaagctgaaggaggctgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatgtaa

DBGET integrated database retrieval system