KEGG   Felis catus (domestic cat): 101091450Help
Entry
101091450         CDS       T02385                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
fca  Felis catus (domestic cat)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Class
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:fca04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:fca04261]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:fca05206]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:fca05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:fca05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B3
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgccttggat
cgagccgagcaggcggaggccgataagaaggcggcggaggacaggagcaagcagctggaa
gatgagctggtgtcgctgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaagttggagctggcggagaaaaaggccactgac
gctgaagccgatgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgactggcaacagctttgcagaagctggaggaggccgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgaaagtcgagcccaaaaggatgaggagaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aagtatgaagaggtggcccgtaagctggtcatcattgagagtgacctggaacgtgcggag
gagcgggctgagctctcagaaagcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tacgaggaagagatcaaggtcctttctgacaagctgaaggaggctgagactcgggctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagacgagctg
tacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgat
atgacttccatgtaa

DBGET integrated database retrieval system