KEGG   Felis catus (domestic cat): 101091450Help
Entry
101091450         CDS       T02385                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain isoform X14
  KO
K10373  tropomyosin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca05206  MicroRNAs in cancer
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    101091450 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    101091450 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101091450 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101091450 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    101091450 (TPM1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     101091450 (TPM1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101091450 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd XhlA DUF1664 Cep57_CLD CLZ DUF16 ADIP Lebercilin CENP-F_leu_zip MscS_porin Fib_alpha Golgin_A5 BST2 GAS HrpB7 Reo_sigmaC TMPIT
Motif
Other DBs
NCBI-GeneID: 101091450
NCBI-ProteinID: XP_011281217
Ensembl: ENSFCAG00000004935
UniProt: A0A2I2ULP8
Position
B3
AA seq 248 aa AA seqDB search
MAGSSSLEAVRRKIRSLQEQADAAEERAGSLQRELDYERKLRETAEADVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAE
DADRKYEEVARKLVIIESDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQ
KEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQ
TLLELNNM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggccgggagcagctcgctggaggcggtgcggaggaaaatccgtagcctgcaggagcag
gcggacgccgcggaggagcgcgcgggcagcctgcagcgcgagctggactacgagaggaag
ctgagggagaccgctgaagccgatgtagcttctctgaacagacgcatccagctggttgag
gaagagttggatcgtgcccaggagcgactggcaacagctttgcagaagctggaggaggcc
gagaaggcagcagatgagagtgagagaggcatgaaagtcattgaaagtcgagcccaaaag
gatgaggagaaaatggaaattcaggagatccaactgaaagaggccaagcacattgctgaa
gatgccgaccgcaagtatgaagaggtggcccgtaagctggtcatcattgagagtgacctg
gaacgtgcggaggagcgggctgagctctcagaaagcaaatgtgccgagcttgaagaagaa
ttgaaaactgtgacgaacaacttgaagtcactggaggctcaggctgagaagtactcgcag
aaggaagacaaatacgaggaagagatcaaggtcctttctgacaagctgaaggaggctgag
actcgggctgagtttgcggagaggtcagtaactaaattggagaaaagcattgatgactta
gaagagaaagtggctcatgccaaagaagaaaaccttagtatgcaccagatgctggatcag
actttactggagttaaacaacatgtga

DBGET integrated database retrieval system