KEGG   Felis catus (domestic cat): 101091508Help
Entry
101091508         CDS       T02385                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
F2
AA seq 450 aa AA seqDB search
MEAPGRPPVGMCAAEVDHQVAQRYLLKRRLGKGAYGIVWKAVDRRTGEVVAIKKIFDAFR
DKTDAQRTFREIMLLQQLGDHPNIIRLLDVIRAENDRDIYLVFESMDTDLNAVICKGRLL
KDVHKRFIMYQLLRATKFIHSGGVIHRDQKPSNILLDASCLVKLCDFGLARPLGGLPEGP
EGPALTDYVATRWYRAPEVLLSSSWYTPGVDMWSLGCVLGEMLRGRPLFPGTSTLHQLEL
ILETIPPPSKEDLLALSSSFSASVLPCLGSRPRQTLDALLPPDTPPEALDLLKGLLVFAP
GKRLSAAQALRHPYVQRFHCPAREQTXXXXXXXSPAPPGPRAGPLTLLGGATKGPQRRTN
PGGWSSDPTDVPCGAENLPRPDVAPLLQPPPPGGLGRAERPPGVTAQAPSGHSAALGGYS
QAYGTVCHSALGRLLLLPGPARKPPCQPET
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccccgggcgcccacctgtcggcatgtgcgccgcggaggtggaccatcaagtt
gcccagagatacctgctcaagcggcggctggggaagggggcctacggcattgtgtggaag
gcagtggataggaggactggcgaagtcgtggccatcaagaaaatcttcgatgcctttagg
gataagacggacgcccagagaacgttccgggaaatcatgctgctccagcaacttggggac
catcctaacatcatccgcctcctggacgtgatccgggcggagaacgacagggacatttac
ctggtgtttgagtctatggacactgacctgaacgccgtcatctgcaagggcaggctgctg
aaggacgtccacaagcgcttcatcatgtaccagctcctgcgggccaccaagttcatccac
tcaggaggcgtcatccaccgggaccagaagccgtccaacattctcctggacgccagctgc
ttggtgaaactctgtgactttggtctcgcccgccctctcgggggcctccctgaggggcct
gagggcccggccctgacagattacgtggccacacgctggtaccgggctccagaggtgctg
ctgtcctcgagctggtacacccctggggtggacatgtggagtctgggctgcgtcctgggg
gagatgcttcgggggagacccctgttcccaggcacatctacactccaccagctggagctg
atcctggagaccatcccgcctccatccaaggaggacctcctggctctcagctcaagcttc
agcgcctcagtcctgccctgcctggggtcccggccacggcagacgctggacgccctcctg
ccgccagacacccccccggaggccctggatctcctcaagggactcctggtatttgccccc
ggcaagcggcttagcgcagcgcaggcgctgcggcacccctacgtgcagaggttccactgc
cccgctcgcgagcagaccnnnnnnnnnnnnnnnnnnnngagcccagcgccccccgggccc
agagcggggcccctgacccttctgggtggagccaccaagggtccgcagcgccggactaac
cccgggggttggtcttcagaccccacagacgttccctgcggagccgagaaccttccccgg
ccggacgtggcgcccctgctccagcccccgcccccagggggtctcgggagggcggaaagg
ccccctggggtgacggcacaggccccctcgggccactcggccgcgctcgggggctattct
caagcctacggtaccgtctgccattcggcgctgggccgcctgctcctgctcccgggcccc
gcgcgtaagccgccctgccagcccgagacctag

DBGET integrated database retrieval system