KEGG   Felis catus (domestic cat): 101091508Help
Entry
101091508         CDS       T02385                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101091508 (MAPK15)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101091508 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
F2
AA seq 316 aa AA seqDB search
MCAAEVDHQVAQRYLLKRRLGKGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFR
EIMLLQQLGDHPNIIRLLDVIRAENDRDIYLVFESMDTDLNAVICKGRLLKDVHKRFIMY
QLLRATKFIHSGGVIHRDQKPSNILLDASCLVKLCDFGLARPLGGLPEGPEGPALTDYVA
TRWYRAPEVLLSSSWYTPGVDMWSLGCVLGEMLRGRPLFPGTSTLHQLELILETIPPPSK
EDLLALSSSFSASVLPCLGSRPRQTLDALLPPDTPPEALDLLKGLLVFAPGKRLSAAQAL
RHPYVQRFHCPAREQT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccgcggaggtggaccatcaagttgcccagagatacctgctcaagcggcggctg
gggaagggggcctacggcattgtgtggaaggcagtggataggaggactggcgaagtcgtg
gccatcaagaaaatcttcgatgcctttagggataagacggacgcccagagaacgttccgg
gaaatcatgctgctccagcaacttggggaccatcctaacatcatccgcctcctggacgtg
atccgggcggagaacgacagggacatttacctggtgtttgagtctatggacactgacctg
aacgccgtcatctgcaagggcaggctgctgaaggacgtccacaagcgcttcatcatgtac
cagctcctgcgggccaccaagttcatccactcaggaggcgtcatccaccgggaccagaag
ccgtccaacattctcctggacgccagctgcttggtgaaactctgtgactttggtctcgcc
cgccctctcgggggcctccctgaggggcctgagggcccggccctgacagattacgtggcc
acacgctggtaccgggctccagaggtgctgctgtcctcgagctggtacacccctggggtg
gacatgtggagtctgggctgcgtcctgggggagatgcttcgggggagacccctgttccca
ggcacatctacactccaccagctggagctgatcctggagaccatcccgcctccatccaag
gaggacctcctggctctcagctcaagcttcagcgcctcagtcctgccctgcctggggtcc
cggccacggcagacgctggacgccctcctgccgccagacacccccccggaggccctggat
ctcctcaagggactcctggtatttgcccccggcaagcggcttagcgcagcgcaggcgctg
cggcacccctacgtgcagaggttccactgccccgctcgcgagcagacc

DBGET integrated database retrieval system