KEGG   Felis catus (domestic cat): 101091579Help
Entry
101091579         CDS       T02385                                 

Gene name
EIF3B
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit B
  KO
K03253  
translation initiation factor 3 subunit B
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101091579 (EIF3B)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101091579 (EIF3B)
Translation factors [BR:fca03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    101091579 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
E3
AA seq 709 aa AA seqDB search
SSPPPPEEPLAPAPASGEAPAEQAGNASAEARSEGAGGEDGGADEPSFSDPEDFVDDVSE
EELLGDILKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEE
DGKTKGYTFLEYASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ
PFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPK
GTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAII
IWDILTGQKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKIS
GIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDY
LCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAP
RISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTV
MNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWR
PRPPTLLSQDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQ
ELYMEQKNERLELRGGVDTDELDSNVEDWEEETIEFFVTEEIIPLGNPE
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
tcgtccccgccgcctcctgaggagccccttgcgcccgccccggcctcgggcgaggcccca
gcggagcaggccgggaacgcgtcggccgaggcccggtccgagggggcgggcggggaggac
ggcggcgcggacgagccttccttcagcgaccccgaggacttcgtggacgatgtgagcgag
gaagaactgctgggggacattctcaaggaccggccgcaggaggcggatgggattgactcg
gtgatcgtggttgacaatgttcctcaggtggggcccgaccggctggagaagctcaaaaac
gtcatccataaaattttttccaagtttgggaaaatcacaaacgatttttatccagaggag
gatggaaagacaaaagggtatacgttcctggaatacgcctcccctgcccatgccttggat
gccgtgaaaaatgcagacggctacaagctggacaagcagcacacgttcagggtcaatctc
ttcactgactttgacaagtatatgacgatcagcgacgaatgggatattccagagaaacag
cccttcaaagacttgggaaacttgcgttactggctcgaggaggcagagtgcagagaccag
tacagtgtcatctttgagagtggggaccgtacttctatcttctggaacgacgtgaaggac
cccgtctccatcgaggagagagcgagatggacggagacctacgtgcgctggtcccccaag
ggcacctacctggccacgttccaccagcgaggcatagctctctgggggggagagaagttc
aaacagatccagagattcagccaccagggggttcagctcattgacttctcgccttgtgag
aggtacctggtgactttcagccccctgatggacactcaggacgatcctcaagccatcatc
atctgggacatcctgaccgggcagaagaagaggggcttccactgtgaaagctcagcccat
tggcctatttttaagtggagccacgatggtaaattctttgccagaatgacactcgacacg
cttagcatctatgaaactccctctatgggtcttttggacaagaagagtttgaagatctct
ggtataaaagacttctcttggtctcccggtgggaacatcatagctttctgggtgcctgaa
gacaaagacatcccggccagggtgaccttgatgcagcttcctaccagacaggagatcagg
gtcaggaatctcttcaatgtggtggattgcaaactacattggcaaaaaaacggagattac
ttgtgcgttaaagtggacaggaccccgaaaggtacccagggcgttgtcacgaattttgaa
attttccgaatgagggaaaaacaggtgcctgtcgacgtggtggaaatgaaagaaaccatc
atagcttttgcctgggaacccaacgggagcaagttcgcagtgctgcacggggaggctcct
cggatatccgtttccttctaccacgtgaagaacaatgggaagattgaacttatcaaaatg
tttgataagcagcaggcaaataccatcttctggagcccccagggacagtttgtcgtcttg
gctggcctaaggagtatgaacggcgccttggccttcgtcgacacttcggattgtacggtc
atgaacatcgcggagcactacatggcgtccgatgtggagtgggaccctaccggacgctac
gtggtcacctctgtgtcctggtggagccataaggtggacaacgcttactggctgtggact
ttccaaggccgtcttctgcagaagaacaacaaggaccgtttctgccagttgctgtggaga
cctcggccccccacgctcctgagccaggaccagatcaagcaaattaaaaaggatctgaag
aaatactccaagatctttgaacagaaggatcgtctgagccaatccaaagcctcaaaggaa
ctagtggagagaagacgcaccatgatggaagatttccgaaaataccggaaaatggcccag
gagctctacatggagcagaaaaatgaacgtttggagttgcgaggaggcgtggacacggac
gagctggacagcaacgtggaagactgggaggaggagaccatcgagttctttgtcaccgag
gagatcatccccctgggcaatccggagtga

DBGET integrated database retrieval system