KEGG   Felis catus (domestic cat): 101091579Help
Entry
101091579         CDS       T02385                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:fca03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E3
AA seq 749 aa AA seqDB search
MQDAENVAAPEAAEQRAEPGQQQPAAEPPPPGEESSRPAGPGAQEAAGGEDXXXXXXXAP
AEQAGNASAEARSEGAGGEDGGADEPSFSDPEDFVDDVSEEELLGDILKDRPQEADGIDS
VIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYTFLEYASPAHALD
AVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQ
YSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKF
KQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGQKKRGFHCESSAH
WPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPE
DKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFE
IFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKM
FDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRY
VVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQDQIKQIKKDLK
KYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTD
ELDSNVEDWEEETIEFFVTEEIIPLGNPE
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcggaaaacgtggcggcgcccgaggcggccgagcagcgggcagagcccggg
cagcagcagccggccgccgagccgccgcccccgggagaggagtcgtcgcggcccgcgggg
cccggcgcgcaggaggcagcaggcggcgaggacgnnnnnnnnnnnnnnnnnnnngcccca
gcggagcaggccgggaacgcgtcggccgaggcccggtccgagggggcgggcggggaggac
ggcggcgcggacgagccttccttcagcgaccccgaggacttcgtggacgatgtgagcgag
gaagaactgctgggggacattctcaaggaccggccgcaggaggcggatgggattgactcg
gtgatcgtggttgacaatgttcctcaggtggggcccgaccggctggagaagctcaaaaac
gtcatccataaaattttttccaagtttgggaaaatcacaaacgatttttatccagaggag
gatggaaagacaaaagggtatacgttcctggaatacgcctcccctgcccatgccttggat
gccgtgaaaaatgcagacggctacaagctggacaagcagcacacgttcagggtcaatctc
ttcactgactttgacaagtatatgacgatcagcgacgaatgggatattccagagaaacag
cccttcaaagacttgggaaacttgcgttactggctcgaggaggcagagtgcagagaccag
tacagtgtcatctttgagagtggggaccgtacttctatcttctggaacgacgtgaaggac
cccgtctccatcgaggagagagcgagatggacggagacctacgtgcgctggtcccccaag
ggcacctacctggccacgttccaccagcgaggcatagctctctgggggggagagaagttc
aaacagatccagagattcagccaccagggggttcagctcattgacttctcgccttgtgag
aggtacctggtgactttcagccccctgatggacactcaggacgatcctcaagccatcatc
atctgggacatcctgaccgggcagaagaagaggggcttccactgtgaaagctcagcccat
tggcctatttttaagtggagccacgatggtaaattctttgccagaatgacactcgacacg
cttagcatctatgaaactccctctatgggtcttttggacaagaagagtttgaagatctct
ggtataaaagacttctcttggtctcccggtgggaacatcatagctttctgggtgcctgaa
gacaaagacatcccggccagggtgaccttgatgcagcttcctaccagacaggagatcagg
gtcaggaatctcttcaatgtggtggattgcaaactacattggcaaaaaaacggagattac
ttgtgcgttaaagtggacaggaccccgaaaggtacccagggcgttgtcacgaattttgaa
attttccgaatgagggaaaaacaggtgcctgtcgacgtggtggaaatgaaagaaaccatc
atagcttttgcctgggaacccaacgggagcaagttcgcagtgctgcacggggaggctcct
cggatatccgtttccttctaccacgtgaagaacaatgggaagattgaacttatcaaaatg
tttgataagcagcaggcaaataccatcttctggagcccccagggacagtttgtcgtcttg
gctggcctaaggagtatgaacggcgccttggccttcgtcgacacttcggattgtacggtc
atgaacatcgcggagcactacatggcgtccgatgtggagtgggaccctaccggacgctac
gtggtcacctctgtgtcctggtggagccataaggtggacaacgcttactggctgtggact
ttccaaggccgtcttctgcagaagaacaacaaggaccgtttctgccagttgctgtggaga
cctcggccccccacgctcctgagccaggaccagatcaagcaaattaaaaaggatctgaag
aaatactccaagatctttgaacagaaggatcgtctgagccaatccaaagcctcaaaggaa
ctagtggagagaagacgcaccatgatggaagatttccgaaaataccggaaaatggcccag
gagctctacatggagcagaaaaatgaacgtttggagttgcgaggaggcgtggacacggac
gagctggacagcaacgtggaagactgggaggaggagaccatcgagttctttgtcaccgag
gagatcatccccctgggcaatccggagtga

DBGET integrated database retrieval system