KEGG   Felis catus (domestic cat): 101091602Help
Entry
101091602         CDS       T02385                                 

Gene name
UNC13A
Definition
unc-13 homolog A (C. elegans)
Orthology
K15293  
protein unc-13
Organism
fca  Felis catus (domestic cat)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    101091602 (UNC13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 1638 aa AA seqDB search
MSGAAAGFKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSVHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEQSLQGSEIEDERDRDS
YHSCHSSVSYHKDSPRWDQDEEELDEELDEELEDFLEEEEEEEDEELEEEEELPDEEEEL
EEEEEVPDDIRSYAQREEVAVAEPKDFKRVSLPPAAAEKEDRPPAGPAEAPDVAKAAPGP
AALEEAPTAERAPEPEPPKSEESFRRREDEEGQEGQDSVSRAKANWLRAFNKVRLQLQEA
RGEGEMSKSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASS
TLNNEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCT
ECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELI
QEIFAVTKTAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQV
GKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFL
GQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHEN
LFHFVTDVQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLS
SKYMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLR
IDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLN
STYEYIFNNCHELYSREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNS
YTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYN
EYVAELPAFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALF
SCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCS
KEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFA
TSFQPHIEECVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKI
CEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDG
TQMIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFL
EKSPDLQSLRYALSLYTQATDLLIKTFVQTQSAQVHGGKGTRFTLSEDIYPEKGSGVEDP
VGEVSVHVELFTHPGTGEHKVTVKVVAANDLKWQTSGIFRPFIEVNIIGPQLSDKKRKFA
TKSKNNSWAPKYNESFQL
NT seq 4917 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggcagctgcagggttcaaaaaagccaagtttgatggtgcccaagagaaattc
aacacgtatgtgaccctgaaggtgcaaaatgtcaagagcacgaccatcgcggtgcggggc
agccagcccagctgggaacaggatttcatgtttgagattaaccgcctggatttggggttg
acggtagaggtgtggaacaagggtctcatctgggacacaatggtgggcaccgtgtggatt
cccctgcggaccatccgccagtccaacgaagagggccctggagagtggctaacactggac
tctcaggtcatcatggcggacagcgagatctgcggcaccaaggaccccaccttccaccgc
atcctccttgacacgcgcttcgagctgcctttagacatccctgaggaggaagcgcgctac
tgggccaagaagctggagcagctgaacgccatgcgggaccaggatgagtattcgttccaa
gatgaacaagacaagcctctccccgtccccagcaaccagtgttgcaactggaattatttt
ggttggggtgaacagcagaacgatgaccctgacagtgcggtggacgatcgcgacagcgac
tatcgcagcgagacaagcaacagcatcccgccaccctattacaccacatcccagcccaat
gcctcggtccaccagtactctgtccgcccaccacccctgggctcccgggaatcttacagt
gactccgtgcacagttatgaggagttctccgagccgcgggccctcagccccaccggcagc
agtcgctacgcctcctcgggggaactgagccagggcagctcgcagctgagcgaggacttc
gacccggacgagcagagcctgcagggctccgagatagaggacgagcgagaccgggactcc
taccactcgtgccacagctcggtcagctaccacaaggactcgccgcgctgggaccaggat
gaggaggagctggacgaggagctggacgaggagctggaggacttcctggaggaggaggag
gaggaggaggacgaggagctggaggaggaggaggagctgcctgacgaggaggaggagctg
gaggaggaggaggaggtgcctgatgacatccggagctacgcccagcgggaggaggtggcc
gtggctgagcccaaagacttcaagcgtgtcagcctcccaccagccgcagctgagaaagag
gataggcctccggccgggcctgctgaggcccccgacgtggccaaggcggcccctgggcca
gccgcactggaggaggcgcccacagcggagcgggcccctgagcccgagccccccaagtct
gaggagagtttcaggcgacgagaggatgaggaaggccaggagggtcaggactccgtgtcc
agggccaaggccaactggcttcgagccttcaacaaagtgcggttgcagctgcaggaggcc
cgaggagaaggagagatgtccaaatccctgtggttcaaaggcggccctggcggtggcctc
atcatcattgacagcatgccggacatccgcaagaggaagcccattccactcgttagcgac
ctggccatgtccctggtccagtccagaaaagcgggcatcacctccgccttggcctccagc
actttgaacaatgaggagctgaaaaaccacgtttacaagaagaccctgcaagccttaatc
taccccatctcctgcacgacgccgcacaacttcgaggtgtggacggccaccacgcccacc
tactgctacgagtgcgaggggctgctgtggggcatcgcgcggcagggcatgcgctgcacg
gagtgcggcgtcaagtgccacgagaagtgccaggacctgctcaacgcagattgcctgcag
cgggctgcagagaagagctccaagcacggggcggaggaccggacgcagaacatcatcatg
gtgctcaaggaccgcatgaagatccgggagcggaacaaacctgagatcttcgagctcatc
caggagatcttcgccgtgaccaagaccgcgcatacgcagcagatgaaggcggtcaagcag
agcgtgctggacggcacgtccaagtggtcggccaagatcagcatcactgtggtctgtgcc
cagggcttgcaggcaaaggacaagacgggatccagtgacccctatgtcactgtccaggtt
gggaagaccaagaaacggacgaaaaccatctatgggaacctgaaccctgtgtgggaggag
aacttccactttgaatgtcacaactcctcagaccgaatcaaggtgcgtgtctgggacgag
gatgatgacatcaaatcccgtgtgaagcagcggtttaagagggaatccgatgacttcctg
ggacagacgatcatcgaggtgcggacactcagcggcgagatggacgtgtggtacaacctg
gacaagcggactgacaaatccgccgtatcaggtgccatccggctacacatcagtgtggag
atcaaaggcgaagaaaaggtggccccctaccatgtccagtacacttgtctacacgagaac
ctgttccacttcgtgacagacgtgcagaacaacggggttgtgaagatcccagatgccaag
ggtgatgacgcctggaaggtttactatgatgagacagcccaggagattgtggatgaattt
gccatgcgctacggcgtcgagtccatctaccaagccatgacccactttgcctgcctctcc
tccaagtacatgtgtcccggggtgcccgccgtcatgagcacccttctcgccaacatcaat
gcctactacgcgcacaccaccgcctccaccaacgtgtccgcctctgaccgcttcgctgcc
tccaactttgggaaagagcgctttgtcaagcttctggaccagctgcacaactcccttcgg
atcgacctctccatgtatcggaataacttcccagccagcagcccagagagactccaggac
ctcaaatccactgtggaccttctcaccagcatcaccttctttcggatgaaggtgcaagaa
ctccagagcccaccccgagccagccaagtggtgaaagattgcgtgaaagcctgcctcaac
tcgacttatgagtacatcttcaacaactgtcatgaactctatagccgggaataccagaca
gatccggctaagaaaggagaagttcccccagaggaacagggacccagcatcaagaacctt
gacttctggtccaagctgatcactctcatagtgtccatcattgaggaagacaagaattca
tacactccctgcctcaaccagtttccccaggagctgaacgtgggtaaaatcagtgctgaa
gtgatgtggaacctgtttgcccaggacatgaagtatgccatggaggagcatgacaagcat
cgcctgtgtaagagtgctgactacatgaacctacacttcaaggtcaagtggctatataac
gagtatgtggcagagcttcctgccttcaaggaccgcgtgcctgagtaccctgcgtggttt
gagccctttgtcatccagtggctggatgagaatgaggaggtgtcccgggatttcctgcat
ggggccctggagcgagacaagaaggatgggttccagcagacctcagagcacgctctgttc
tcctgctccgtggtggacgtcttctcccagctcaaccagagctttgagatcatcaagaaa
cttgagtgccctgacccccagatcgtggggcactatatgaggcgctttgccaagaccatc
agtaatgtgctcctccagtatgcagacatcatctccaaggacttcgcctcttactgctcc
aaggagaaggagaaagtgccctgcatcctcatgaacaacactcagcagctccgagtgcag
ctggagaagatgttcgaagccatgggaggaaaagagctggatgctgaggccagtgacatc
ttgaaggagctccaggtgaaactcaacaatgtcttggacgagctcagccgggtgtttgct
accagcttccagccacacatcgaggagtgtgtcaagcagatgggtgacatcctcagccag
gtgaagggcacgggcaacgtgccagccagtgcctgcagcagcgtggcccaggacgctgac
aatgtactgcaacccatcatggacctgctggacagcaacctgactctctttgccaaaatc
tgcgagaagacggtgctgaagcgggtgctgaaggagttatggaagctggtcatgaacacc
atggagaagaccatcgtcttgccacccctcaccgaccagacgatgatcggcaccctcttg
agaaaacatggcaagggattagaaaagggcagggtgaaattgccaagccactcagatgga
acccagatgatcttcaatgcagccaaagaactgggtcagctgtctaaactcaaggaccac
atggtacgagaagaagccaagagcttgaccccgaagcagtgtgcagtagttgagctggcc
ctggacaccatcaagcaatacttccacgcaggtggcgtgggcctcaagaagaccttcctg
gagaagagcccagacctgcagtccctgcgctacgccctgtccctctacacgcaggccacc
gacctgctcatcaagaccttcgtgcagacgcaatcggcccaggtccatggtggaaaaggg
actaggtttacccttagtgaagacatttatcctgagaagggctcgggtgtggaagaccct
gtgggtgaagtttcagtccacgtcgagctcttcactcatccggggaccggggagcacaag
gtcactgtgaaagtggtggcggccaatgacctcaagtggcagacctctggcattttccgg
ccattcatcgaggtcaacatcatcgggccccagctcagcgacaagaaacgcaagtttgca
accaaatccaagaacaacagctgggcccccaagtacaacgagagcttccagttgtga

DBGET integrated database retrieval system