KEGG   Felis catus (domestic cat): 101091618Help
Entry
101091618         CDS       T02385                                 

Gene name
PRKG2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
fca  Felis catus (domestic cat)
Pathway
Gap junction
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Class
Cellular Processes; Cell communication; Gap junction [PATH:fca04540]
Organismal Systems; Digestive system; Salivary secretion [PATH:fca04970]
Organismal Systems; Nervous system; Long-term depression [PATH:fca04730]
Organismal Systems; Sensory system; Olfactory transduction [PATH:fca04740]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:fca04713]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B1
AA seq 646 aa AA seqDB search
MGNGSVKPKHSKHPDGHSGNLTTHALRSKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQSKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKASGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNRNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGERLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISEDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTG
NT seq 1940 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacccaaacattctaagcatccagatggccactccgggaac
ctcaccacccatgcgctgcggagcaaggtgacagagctggagagggagctgaggaggaag
gatgctgagatccaggagcgggaataccatttgaaggagctgcgggaacagctgtcgaag
cagaccgtggccattgctgagctcacagaggagctccagagcaagtgcatccagctgaac
aagcttcaggatgtggtgcatatgcagggaggaagtccgcttcaggcctctccagataaa
gtgcctcttgaggtccaccggaaggcctcgggattggtctccctccatagccggagggga
gcaaaagcaggggtgtctgctgaacccaccacccgaacctatgacctcaataaaccccct
gaattttcttttgagaaagcaagggtcagaaaggactccagcgagaagaagctcattaca
gatgcccttaatagaaatcagtttctgaagagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatggtagaaactaccagcaagggagttacattattaagcaaggagaa
ccaggaaaccatatctttgtgctagcagagggtcgactagaggtgttccaaggggagaga
ttgctgtcatccatccctatgtggaccacgtttggggagctagccattttatacaactgt
acaagaactgcctctgtgaaagctattaccaatgttaaaacttgggcactagatcgagag
gtattccagaatataatgagaaggacagctcaagctagagatgaacagtacagaaacttc
ctcagaagtgtatccttgctgaagaatttacctgaagataaattaaccaagatcattgac
tgcttggaagtggaatactatgacaaaggagattacattattagagagggcgaggaagga
agtaccttcttcattttagcaaaaggaaaggtaaaagtcacccagagcacagagggccac
gatcagccacaactgataaaaacactgcagaaaggagaatactttggagaaaaagctctt
atcagtgaggatgtcagatcagctaacatcatcgccgaagaaaatgatgttgcatgcctg
gttatagatcgagagacattcaaccaaacagtcgggacttttgaagaactccaaaaatac
cttgaagggtatgtggcaaacctaaaccgtgatgatgagaaaagacatgcaaagagatcc
atgtctaactggaagctgtccaaagcactctctctggagatgattcagctgaaggagaag
gtggccagattttcctcatcatccccattccagaaccttgagattattgcaacactgggc
gttggtgggttcggaagagttgagcttgttaaagtgaaaaatgagaatgtggcttttgct
atgaagtgtataaggaagaagcacatcgttgacactaagcaacaggagcacgtttactca
gaaaagaggattctagaagagttgtgttctcccttcatcgtgaaattatatcgtactttc
aaggacaataagtatgtgtacatgcttctggaggcctgcttaggtggggagctatggagt
atattaagggacagaggcagctttgatgagcccacctccaagttctgcgtggcttgtgtg
acagaagcatttgattacctgcaccgactaggtattatctacagagacctgaaaccagaa
aacttaattctagatgctgagggttatcttaaattggttgactttggatttgctaagaaa
ataggatctggacagaaaacgtggacgttctgtggaactccagagtatgtagctcctgaa
gtcattctcaacaaaggacatgacttcagtgtggatttttggtccctgggaattctagtg
tatgagctcctcactggcaa

DBGET integrated database retrieval system