KEGG   Felis catus (domestic cat): 101091618Help
Entry
101091618         CDS       T02385                                 

Gene name
PRKG2
Definition
(RefSeq) protein kinase, cGMP-dependent, type II
  KO
K19477  
cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
fca  Felis catus (domestic cat)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Regulation of lipolysis in adipocytes
Renin secretion
Salivary secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    101091618 (PRKG2)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101091618 (PRKG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101091618 (PRKG2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101091618 (PRKG2)
   04924 Renin secretion
    101091618 (PRKG2)
  Digestive system
   04970 Salivary secretion
    101091618 (PRKG2)
  Nervous system
   04730 Long-term depression
    101091618 (PRKG2)
  Sensory system
   04740 Olfactory transduction
    101091618 (PRKG2)
  Environmental adaptation
   04713 Circadian entrainment
    101091618 (PRKG2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     101091618 (PRKG2)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   101091618 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
B1
AA seq 792 aa AA seqDB search
MLTSKLQSCCDAFDSCPRRTTRENSRSLSKMGNGSVKPKHSKHPDGHSGNLTTHALRSKV
TELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTEELQSKCIQLNKLQDVVHMQG
GSPLQASPDKVPLEVHRKASGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVR
KDSSEKKLITDALNRNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAE
GRLEVFQGERLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTA
QARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGK
VKVTQSTEGHDQPQLIKTLQKGEYFGEKALISEDVRSANIIAEENDVACLVIDRETFNQT
VGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPF
QNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCS
PFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRL
GIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFS
VDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRSN
PTERLGNLKNGINDIKRHRWLNGFNWEGLKARNLPSPLQRELSGPTDHSYFDKYPPEKGV
PPDELSGWDKDF
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgctgacttccaaattgcagtcttgttgtgatgcttttgacagctgtccaaggagaacg
accagagagaacagcaggtccttgagcaaaatgggaaatggttcagtgaaacccaaacat
tctaagcatccagatggccactccgggaacctcaccacccatgcgctgcggagcaaggtg
acagagctggagagggagctgaggaggaaggatgctgagatccaggagcgggaataccat
ttgaaggagctgcgggaacagctgtcgaagcagaccgtggccattgctgagctcacagag
gagctccagagcaagtgcatccagctgaacaagcttcaggatgtggtgcatatgcaggga
ggaagtccgcttcaggcctctccagataaagtgcctcttgaggtccaccggaaggcctcg
ggattggtctccctccatagccggaggggagcaaaagcaggggtgtctgctgaacccacc
acccgaacctatgacctcaataaaccccctgaattttcttttgagaaagcaagggtcaga
aaggactccagcgagaagaagctcattacagatgcccttaatagaaatcagtttctgaag
agactggatcctcagcagatcaaagacatggtggaatgcatgtatggtagaaactaccag
caagggagttacattattaagcaaggagaaccaggaaaccatatctttgtgctagcagag
ggtcgactagaggtgttccaaggggagagattgctgtcatccatccctatgtggaccacg
tttggggagctagccattttatacaactgtacaagaactgcctctgtgaaagctattacc
aatgttaaaacttgggcactagatcgagaggtattccagaatataatgagaaggacagct
caagctagagatgaacagtacagaaacttcctcagaagtgtatccttgctgaagaattta
cctgaagataaattaaccaagatcattgactgcttggaagtggaatactatgacaaagga
gattacattattagagagggcgaggaaggaagtaccttcttcattttagcaaaaggaaag
gtaaaagtcacccagagcacagagggccacgatcagccacaactgataaaaacactgcag
aaaggagaatactttggagaaaaagctcttatcagtgaggatgtcagatcagctaacatc
atcgccgaagaaaatgatgttgcatgcctggttatagatcgagagacattcaaccaaaca
gtcgggacttttgaagaactccaaaaataccttgaagggtatgtggcaaacctaaaccgt
gatgatgagaaaagacatgcaaagagatccatgtctaactggaagctgtccaaagcactc
tctctggagatgattcagctgaaggagaaggtggccagattttcctcatcatccccattc
cagaaccttgagattattgcaacactgggcgttggtgggttcggaagagttgagcttgtt
aaagtgaaaaatgagaatgtggcttttgctatgaagtgtataaggaagaagcacatcgtt
gacactaagcaacaggagcacgtttactcagaaaagaggattctagaagagttgtgttct
cccttcatcgtgaaattatatcgtactttcaaggacaataagtatgtgtacatgcttctg
gaggcctgcttaggtggggagctatggagtatattaagggacagaggcagctttgatgag
cccacctccaagttctgcgtggcttgtgtgacagaagcatttgattacctgcaccgacta
ggtattatctacagagacctgaaaccagaaaacttaattctagatgctgagggttatctt
aaattggttgactttggatttgctaagaaaataggatctggacagaaaacgtggacgttc
tgtggaactccagagtatgtagctcctgaagtcattctcaacaaaggacatgacttcagt
gtggatttttggtccctgggaattctagtgtatgagctcctcactggcaaccctcccttt
tccgggattgaccaaatgatgacctacaatttgattctcaaaggaattgaaaaaatggat
tttcccagaaagataacaagaaggcctgaggatttgattcgcaggctttgcaggtcaaat
ccaacggagagacttggaaatctgaagaatggaatcaatgacattaagagacacaggtgg
ttaaatggttttaattgggagggactgaaagcgcggaaccttccatcacctttacaaaga
gagctcagtggacccacagaccacagctactttgacaagtatcctcctgaaaagggtgtg
cctccagatgaactgtcaggctgggataaagacttctga

DBGET integrated database retrieval system