KEGG   Felis catus (domestic cat): 101091725Help
Entry
101091725         CDS       T02385                                 

Gene name
TGFBR2
Definition
transforming growth factor, beta receptor II (70/80kDa)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101091725 (TGFBR2)
   04350 TGF-beta signaling pathway
    101091725 (TGFBR2)
   04390 Hippo signaling pathway
    101091725 (TGFBR2)
   04068 FoxO signaling pathway
    101091725 (TGFBR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101091725 (TGFBR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101091725 (TGFBR2)
  Cellular commiunity
   04520 Adherens junction
    101091725 (TGFBR2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    101091725 (TGFBR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101091725 (TGFBR2)
   05202 Transcriptional misregulation in cancers
    101091725 (TGFBR2)
   05210 Colorectal cancer
    101091725 (TGFBR2)
   05212 Pancreatic cancer
    101091725 (TGFBR2)
   05220 Chronic myeloid leukemia
    101091725 (TGFBR2)
  Infectious diseases
   05166 HTLV-I infection
    101091725 (TGFBR2)
   05142 Chagas disease (American trypanosomiasis)
    101091725 (TGFBR2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101091725 (TGFBR2)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   101091725 (TGFBR2)
Enzyme-linked receptors [BR:fca01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   101091725 (TGFBR2)
Cytokine receptors [BR:fca04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   101091725 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C2
AA seq 594 aa AA seqDB search
MAAVCQMVASVSDSEMPTAIKNLLSENKSFNSGPICSGRFYNNKEKDEASSLGTYDVIFN
NGMMVTDNNGIIKFPQLCKFCDVRSSTCDSQKSCLSNCSITSICERPHEVCLAVWRKNDE
NITLETLCHDPKVTYHGIALEDSASPKCIMKEKKVLGETFFMCSCSTDECNDYIIFSEEY
ATSNPDLLLVIFQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPSWDTSKPRKLMEFS
EHLAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFET
VAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNL
QEYLTRHVISWEDLRTLGSSLARGIAHLHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTC
CLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALV
LWEMTSRCNAVGEVKEYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMV
CETLTECWDHDPEARLTAQCVAERFSELQHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtctgccagatggtcgcctcagtgtctgactccgaaatgccaactgcaatt
aaaaaccttctttcagagaacaagtctttcaattctgggcccatatgcagtggtcgcttt
tacaataataaggagaaagatgaggcctcttcactgggtacttacgacgtgatatttaac
aatggcatgatggtcaccgacaacaatggtatcatcaagtttccgcaattgtgcaaattt
tgtgatgtgagatcttccacctgtgacagtcagaaatcctgcctgagcaactgcagcatc
acgtctatctgcgagaggccacacgaagtctgtctggccgtctggagaaagaacgatgag
aacataaccctagagacgctttgccatgaccccaaggttacctaccatggaattgctctt
gaggactctgcttctcccaagtgtattatgaaggaaaaaaaggtgttgggcgagactttc
tttatgtgttcctgtagcaccgatgaatgcaatgactacatcatcttctcagaagaatac
gccaccagcaaccctgacctgttgttagtcatattccaagtgacaggcgtcagcctcctg
ccccccctggggatcgccatagccgtcatcatcatcttctactgctaccgtgttcaccgg
cagcagaagctgagcccatcctgggataccagcaagccacgaaagctcatggagttcagc
gagcaccttgccatcattctggaagacgaccgctctgacatcagctctacctgcgccaac
aacatcaaccacaacacagagctgctgcccattgagctggacaccctggtgggcaaaggc
cgcttcgccgaggtctacaaggccaagctgaagcagaacacttctgaacagttcgagacc
gtggcggtcaagatcttcccttacgaggagtacgcctcctggaagacggagaaggacatt
ttctcagacatcaacctgaagcacgagaacatactgcagttcctgacagccgaggagcgc
aagacggagctggggaagcagtactggctgatcacggccttccacgccaagggcaacctg
caggagtacctgacgcggcacgtcatcagctgggaggacctgcgcacgctgggcagctcc
ctcgcccggggcatcgcccacctgcacagcgaccacaccctgtgcgggaggcccaagatg
cccatcgtgcacagggacctcaagagctccaatatcctcgtcaagaacgatctgacctgc
tgcctgtgtgactttgggctttccctgcgtctggacccgaccctgtctgtggatgacctg
gccaacagcgggcaggtgggaactgcaagatacatggctccagaagtcctagagtccagg
atgaatttggagaatgttgagtcctttaagcagacggatgtctactccatggctctggtc
ctctgggaaatgacatctcgctgtaatgcggtaggagaggtgaaagagtacgagcctcca
tttggttccaaggtgcgggagcatccctgtgttgagagcatgaaggacaatgtgctgaga
gaccgaggacgaccagaaattcccagctcctggctcaaccaccagggcatccagatggtg
tgcgagactctgaccgagtgctgggaccatgacccggaggcccggctcacggcccagtgc
gtggcagagcgcttcagtgaactgcagcacctggacaggctctcggggaggagctgctcc
gaggagaagattcccgaagatggctcgttgaacactaccaaatag

DBGET integrated database retrieval system