KEGG   Felis catus (domestic cat): 101091765Help
Entry
101091765         CDS       T02385                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
fca  Felis catus (domestic cat)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101091765 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101091765 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A2
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSSTIALEL
LKQGASPNVQDTSGTTPAHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVREGHT
AVVSFLASESDLHHRDARGLTPLELAQGIGAQDLMDILQGHSVVPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggtccgcgcaggcgacaggctaagcggggccgcggcccgaggcgac
gtgcaggaggtgcgccgccttctgcaccgtgagctggtgcaccccgatgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggaagctccaccattgcgctggaactt
ctcaagcaaggtgccagccccaatgtccaggacacctccggcaccactccagcccatgat
gcggcacgcactggattcctggacaccctgaaggttttggtagagcatggtgctgatgtc
aacgtgcctgacggcaccggggcactccccatccatctggcggtgcgagagggccacacc
gctgtggtcagcttcctggcttctgagtctgatctccatcacagggacgccagggggctc
acgcccctggagctggcacaggggataggggcccaggatctcatggacatactgcagggg
cactcggtggtaccgctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system