KEGG   Felis catus (domestic cat): 101091765Help
Entry
101091765         CDS       T02385                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
fca  Felis catus (domestic cat)
Pathway
FoxO signaling pathway
Cell cycle
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:fca04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:fca04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A2
AA seq 166 aa AA seqDB search
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSSTIALEL
LKQGASPNVQDTSGTTPAHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVREGHT
AVVSFLASESDLHHRDARGLTPLELAQGIGAQDLMDILQGHSVVPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggaggaggtccgcgcaggcgacaggctaagcggggccgcggcccgaggcgac
gtgcaggaggtgcgccgccttctgcaccgtgagctggtgcaccccgatgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgtttggaagctccaccattgcgctggaactt
ctcaagcaaggtgccagccccaatgtccaggacacctccggcaccactccagcccatgat
gcggcacgcactggattcctggacaccctgaaggttttggtagagcatggtgctgatgtc
aacgtgcctgacggcaccggggcactccccatccatctggcggtgcgagagggccacacc
gctgtggtcagcttcctggcttctgagtctgatctccatcacagggacgccagggggctc
acgcccctggagctggcacaggggataggggcccaggatctcatggacatactgcagggg
cactcggtggtaccgctgtga

DBGET integrated database retrieval system