KEGG   Felis catus (domestic cat): 101091824Help
Entry
101091824         CDS       T02385                                 

Gene name
PFN1
Definition
(RefSeq) profilin-1
  KO
K05759  profilin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101091824 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101091824 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101091824 (PFN1)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Others
    101091824 (PFN1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     101091824 (PFN1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101091824 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 101091824
NCBI-ProteinID: XP_023099194
Position
E1
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH
GGMINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc
gtgaacgggctgacacttgggggccagaaatgctctgttatccgggactcgctgctgcag
gacggggaatttaccatggatctccgtaccaagagcaccggcggagctcccaccttcaac
atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggcgggatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system