KEGG   Felis catus (domestic cat): 101091870Help
Entry
101091870         CDS       T02385                                 

Gene name
USP49
Definition
ubiquitin specific peptidase 49
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B2
AA seq 545 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWCCRECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDPPLRRGRTLRSM
ASGEDAVPPQRAPQGQPQMLTALWYRRQRLPKAPNGKAPLSGRPAGSSATELSARSDRAE
SCEREGLCFNGGASISRSLELIQNKEPSSKHISLCHELHTLFRVMWSGKWALVSPFAMLH
SVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGTTRRILIPFSQRKLTKQVLKVVNT
IFHGQLLSQVTCVSCNYKSNTIEPFWDLSLEFPERYHCIEKGFVPLNQTECLLTEMLAKF
TETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIYRLPQVLRLHLKRFRWSGRNH
REKIGVHVVFDQVLNMEPYCCRDMLSSLDKETFAYDLSAVVMHHGKGFGSGHYTAYCYNT
EGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQGNARISETQLQAQVQPSNNDEGR
PRTFP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgtcgggcggttgcggctcgcccaggaccactccatcctgaac
ccgcagaagtggtgctgcagggagtgcgccaccaccgagtcggtgtgggcttgtctcaag
tgctcccacgtggcctgcggccgctacatcgaggatcacgcccttaaacactttgaggag
actgggcacccgctagctatggaggtccgagatctgtacgtgttctgttacctgtgcaag
gactatgtgctcaacgataaccccgagggagacctgaagctgctcagaagctccctcctg
gcggtcaggggccagaagcaggacccgccgctgaggcgcggccggacgctgcggtccatg
gcctcgggcgaggacgccgtcccgccgcagcgcgctcctcagggacagccgcagatgctc
acggctctgtggtaccggcgccagcgccttcccaaggcccccaacgggaaggctccgctc
tcgggcaggccggccggcagctcggccaccgagctgtcggccaggagcgaccgggcggag
tcgtgcgagcgggagggcctctgcttcaacggcggggcctccatcagcaggagcctagaa
ctcatccagaacaaggagccgagctcgaagcacatttccctctgtcacgaactgcacacc
ctcttccgtgtcatgtggtccggcaagtgggccctggtgtcccccttcgccatgcttcac
tccgtttggagcctgatccccgccttccggggctacgaccagcaggacgcgcaggaattc
ctctgtgagctgttgcacaaagtacagcaagagctcgagtccgagggtaccacgcgccgg
atcctcatccctttctcccagaggaagctcaccaaacaggtcttaaaggtggtgaacacc
atattccacgggcagctactcagtcaggttacatgtgtatcatgcaattacaaatccaat
accattgagcccttttgggatttgtccctggaattccctgaacggtatcactgcatagaa
aaggggtttgtccctttgaatcagactgagtgcctgctcactgagatgctggccaagttc
acagagacagaggccctggaagggagaatctacgcttgtgaccagtgtaacagcaaacga
cgaaaatccaatccaaaaccccttgttctgagtgaagctagaaagcagttaatgatctac
agactacctcaggtcctccggctgcaccttaaaagattcaggtggtctggccgtaatcat
cgagagaagattggggtccatgtcgtctttgaccaggtattaaacatggaaccttactgc
tgcagggacatgctctcctctcttgacaaagagacctttgcctatgatctctccgcagtg
gtcatgcatcacgggaaagggtttggctcaggacactacacagcctattgctacaacaca
gagggaggtttttgggtccactgcaatgactcaaagctgaatgtatgcagtgtcgaggaa
gtgtgcaaaactcaagcctacatccttttttacactcaaagaacagttcagggcaatgca
agaatttcagaaacccaactccaagctcaggtgcagcccagcaacaacgatgagggcaga
ccacggaccttcccctga

DBGET integrated database retrieval system