KEGG   Felis catus (domestic cat): 101092057Help
Entry
101092057         CDS       T02385                                 

Gene name
MAPK4
Definition
(RefSeq) mitogen-activated protein kinase 4
  KO
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    101092057 (MAPK4)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101092057 (MAPK4)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101092057 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
D3
AA seq 583 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKITLSDSRSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLKVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDILLMAANQSQLSNWDRYPVSLSSD
LEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSQSSSERFLERSHSSMERAFEADC
GRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPSAAVAADAGPRED
EPASLFLEIAQWVKSTQVGPERASPPPDSPERRLSASPPGHPAPIDGGGSPQFDLDVFIS
RALKLCTNPEDLPDNKLGDLNGGCISEHPGDLVQTEAFSKERW
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagggcgactgcatcgccagtgtctatgggtatgaccttggtgggcgcttc
gttgacttccaacccctgggttttggtgtcaatgggctggtgctgtcagctgtggacagc
agggcctgccggaaggtggctgtgaagaagatcaccctgagtgactcccgcagcatgaag
catgcgctccgggagatcaagatcatccggcgcctggaccatgacaacatcgtgaaggtg
tatgaggtgctggggcccaagggcactgacctgcagggcgagctgttcaagttcagcgtg
gcctacattgtccaggagtacatggagaccgacctggcacgcctgttggagcaaggcacg
ctgacagaggaacacgcaaagctgttcatgtaccagctgctccgagggctcaagtacatc
cactccgccaacgtgctgcacagggacctgaagcccgccaacatcttcattagcacggag
gacctcgtgctcaagatcggggatttcgggttggcgaggatcgttgaccagcattattca
cacaagggctatctgtcggaagggttggtaactaagtggtaccgctcaccacgcctgctc
ctctccccgaacaactacaccaaagccattgacatgtgggccgccggctgcatcctggcc
gagatgctcacggggagaatgctctttgccggggcccacgagctggagcagatgcagctc
atcctggagaccatccccgtgatccgggaggaggacaaagacgagctgctcaaggtgatg
ccttccttcgtcagcagcacctgggaggtgaagcggccgctgcgcaagctgctgcccgaa
gtgaacagcgaagccattgactttctggagaagatcctgacctttaaccccatggatcgc
ctaacagcagagatggggctgcagcatccctacatgagcccatactcgtgccccgaggac
gagcccacctcacagcaccccttccgcatcgaagatgagatcgacgacatcctgctgatg
gccgccaaccagagccagctctccaactgggacaggtaccctgtgagcctgtcatcggac
ctggagtggaggccggacagatgtcaggacgccagcgaggtacagcgcgacccgcgcgcg
ggctccgcgccgctggctgaggacgtgcaggtggatccgcgcaaggactcgcagagcagc
tccgagcgctttctggagcgctcgcactcgtccatggagcgcgccttcgaggccgactgc
ggccgctcctgcgactacaaagtgggctcgccgtcctacctggataagctgctgtggcgc
gacaacaagccgcaccactactcggagcccaagctcattctggacctgtcgcactggaag
caggcggccggggcgccccccagtgccgcggtggccgcagacgccgggccacgcgaagac
gagccggccagcctcttcctggagatcgcgcagtgggtcaagagcacgcaggtgggcccc
gagcgcgccagcccaccccccgacagccccgagcgccgcctgtctgcctctccaccgggc
caccccgcacccatcgacgggggcgggagcccccagttcgacctggacgtgttcatctcc
cgcgccctgaagctctgcaccaacccggaggacctgccagacaataaactgggtgacctc
aatggtgggtgcatctctgagcaccctggcgatcttgtgcagacagaggccttctccaaa
gaaaggtggtga

DBGET integrated database retrieval system