KEGG   Felis catus (domestic cat): 101092057Help
Entry
101092057         CDS       T02385                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D3
AA seq 590 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKITLSDSRSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLKVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDILLMAANQSQLSNWDRCSSRGLQY
PVSLSSDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSQSSSERFLERSHSSME
RAFEADCGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPSAAVAA
DAGPREDEPASLFLEIAQWVKSTQVGPERASPPPDSPERRLSASPPGHPAPIDGGGSPQF
DLDVFISRALKLCTNPEDLPDNKLGDLNGGCISEHPGDLVQTEAFSKERW
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagggcgactgcatcgccagtgtctatgggtatgaccttggtgggcgcttc
gttgacttccaacccctgggttttggtgtcaatgggctggtgctgtcagctgtggacagc
agggcctgccggaaggtggctgtgaagaagatcaccctgagtgactcccgcagcatgaag
catgcgctccgggagatcaagatcatccggcgcctggaccatgacaacatcgtgaaggtg
tatgaggtgctggggcccaagggcactgacctgcagggcgagctgttcaagttcagcgtg
gcctacattgtccaggagtacatggagaccgacctggcacgcctgttggagcaaggcacg
ctgacagaggaacacgcaaagctgttcatgtaccagctgctccgagggctcaagtacatc
cactccgccaacgtgctgcacagggacctgaagcccgccaacatcttcattagcacggag
gacctcgtgctcaagatcggggatttcgggttggcgaggatcgttgaccagcattattca
cacaagggctatctgtcggaagggttggtaactaagtggtaccgctcaccacgcctgctc
ctctccccgaacaactacaccaaagccattgacatgtgggccgccggctgcatcctggcc
gagatgctcacggggagaatgctctttgccggggcccacgagctggagcagatgcagctc
atcctggagaccatccccgtgatccgggaggaggacaaagacgagctgctcaaggtgatg
ccttccttcgtcagcagcacctgggaggtgaagcggccgctgcgcaagctgctgcccgaa
gtgaacagcgaagccattgactttctggagaagatcctgacctttaaccccatggatcgc
ctaacagcagagatggggctgcagcatccctacatgagcccatactcgtgccccgaggac
gagcccacctcacagcaccccttccgcatcgaagatgagatcgacgacatcctgctgatg
gccgccaaccagagccagctctccaactgggacaggtgcagttccagaggcctccagtac
cctgtgagcctgtcatcggacctggagtggaggccggacagatgtcaggacgccagcgag
gtacagcgcgacccgcgcgcgggctccgcgccgctggctgaggacgtgcaggtggatccg
cgcaaggactcgcagagcagctccgagcgctttctggagcgctcgcactcgtccatggag
cgcgccttcgaggccgactgcggccgctcctgcgactacaaagtgggctcgccgtcctac
ctggataagctgctgtggcgcgacaacaagccgcaccactactcggagcccaagctcatt
ctggacctgtcgcactggaagcaggcggccggggcgccccccagtgccgcggtggccgca
gacgccgggccacgcgaagacgagccggccagcctcttcctggagatcgcgcagtgggtc
aagagcacgcaggtgggccccgagcgcgccagcccaccccccgacagccccgagcgccgc
ctgtctgcctctccaccgggccaccccgcacccatcgacgggggcgggagcccccagttc
gacctggacgtgttcatctcccgcgccctgaagctctgcaccaacccggaggacctgcca
gacaataaactgggtgacctcaatggtgggtgcatctctgagcaccctggcgatcttgtg
cagacagaggccttctccaaagaaaggtggtga

DBGET integrated database retrieval system