KEGG   Felis catus (domestic cat): 101092120Help
Entry
101092120         CDS       T02385                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fca  Felis catus (domestic cat)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101092120 (GCH1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     101092120 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B3
AA seq 122 aa AA seqDB search
MVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQ
IAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI
KS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtgattgtgaaggacatagatatgttttccatgtgtgaacatcatctggttccattt
gttggaaaggtccatattggctatcttcctaacaagcaagtccttggccttagcaaactt
gcgaggattgtagaaatctatagtagacgattacaagttcaagagcgtcttacaaaacaa
atcgcggtagccatcacagaagccttgcggcccgctggagttggggtggtggtggaagca
acacacatgtgtatggtaatgcgaggggtacagaaaatgaacagcaaaactgtgaccagc
acgatgttgggtgtgttccgggaagatccaaagactcgggaagagtttctaactctcatt
aagagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system