KEGG   Felis catus (domestic cat): 101092123Help
Entry
101092123         CDS       T02385                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
fca  Felis catus (domestic cat)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101092123 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101092123 (GYS2)
   04152 AMPK signaling pathway
    101092123 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101092123 (GYS2)
   04922 Glucagon signaling pathway
    101092123 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101092123 (GYS2)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101092123 (GYS2)
Glycosyltransferases [BR:fca01003]
 Polysaccharide
  Storage polysaccharide
   101092123 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B4
AA seq 702 aa AA seqDB search
MLRGRSLSVTSLSGLPRWEVEELPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVERCEPINDAIRRAVDTMNKHGCQVYFGRWLIEGSPYVVLFDI
GSSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLSVKKFSAVHEFQNLHATY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLEALSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDVTVMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFQSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARYLTLSRAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVSSPQSSDVE
DEEDERYNEEEEAERDRLNIKSPWSLGRVPRGKKKLHGEYKN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatctctatctgtgacatccctgagcgggcttcctcggtgggaagtg
gaagaacttcctgtggaggatttactactgtttgaagtcgcttgggaagtaaccaataaa
gttggtggcatctatactgtaattcagacgaaggccaaaaccacagcagatgaatgggga
gacaattattttctgattggcccctattttgagcataatatgaagactcaggtggaacgg
tgtgaacctataaatgatgctatcagaagagcagtggatacaatgaataaacatggctgc
caggtgtactttggaaggtggctgatagaagggagtccttacgtggtgctatttgacata
ggctcttcggcttggaacctggacaggtggaagggagatctctgggaagcatgcagtgtc
ggcatcccttatcatgaccgagaagccaatgatatgctaatattcggatctttaaccgcc
tggttcttaaaagaggtgacggatcatgcagatgggaaacatgtcattgcccaattccat
gaatggcaggcaggaactggactgatcctttctcgagctcggaagcttcctatcgctaca
atatttaccactcatgccacactgcttggcaggtatctctgtgcagcaaacattgatttc
tacaaccatctcgataagtttgacatagacaaagaggctggggaaaggcagatttaccac
cggtattgcatggagcgagcctctgtccattgtgctcatgtgttcaccacagtatctgaa
ataacagcaatagaggcagaacatatgctgaagagaaagcctgatgtagttactccaaat
ggcttgagtgttaagaaattttcagcagtacatgagtttcaaaatctacatgccacgtac
aaggccaggatccaagattttgttcgaggtcatttctatggtcatctggactttgacctt
gaaaagactttgttccttttcattgctgggagatacgagttttcaaacaaaggagctgac
atcttcctagaagccttatccaggttaaatttcctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcattatgcctgccaagacaaacaatttcaatgtggaaaccctg
aaaggccaggcagtgcggaaacaactatgggacattgcacattctgtgaaggaaaaattt
ggaaagaaactctatgatgcattattaagaggagaaattcctgacatgaacaatattttg
gatcgagatgatgtaacagttatgaaaagagccatcttttcaactcagcgacagtctttg
cctccagtgaccactcacaacatgattgatgactccactgatcccatcctcagcaccatt
agacggatcggacttttcaacaaccgcacagacagagtcaaggtgattttgcacccagag
ttcctatcctccaccagccccttattacccatggattatgaagagtttgttcgaggttgt
catctaggagtttttccttcatactatgaaccatggggttatactccagctgaatgtacg
gtgatgggtatccccagtgtgacaaccaacctgtccggctttggctgtttcatgcaggag
cacgtggctgatcctactgcctacggcatttacattgttgacaggcggttccagtctcca
gatgattcctgcaatcagctaactcagtttctctatggattttgcaaacagtcccgccgc
cagagaattattcagagaaaccgaactgagaggctctctgatcttctggattggagatac
ttgggcagatattatcaacatgccaggtacctgacattaagcagagcttttccagataaa
ttccatatggaacctacatcaccaccaacaacagaaggatttaaatatcccaggccttcc
tcagttccaccttccccttcagggtctcaggtctctagtcctcagagcagtgatgtggaa
gatgaagaggatgagcgctacaatgaggaagaggaggctgaaagggatcggttaaatatc
aagtcgccatggtctctgggccgtgttcctcgtgggaagaaaaagctgcatggtgaatac
aagaactga

DBGET integrated database retrieval system