KEGG   Felis catus (domestic cat): 101092160Help
Entry
101092160         CDS       T02385                                 

Gene name
POM121C, POM121
Definition
(RefSeq) POM121 transmembrane nucleoporin C
  KO
K14316  
nuclear pore complex protein Nup121
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101092160 (POM121C)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     101092160 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
E3
AA seq 1031 aa AA seqDB search
MSPAAAAAGGGERRRPIASARDGRGRSGGCGGSAGAALLGLSLFGLVLYLVPAAAALAWL
AXGATAAWWGLSREPRGSRALSSLVRSARRQRALHASPPAKSAVNGSLLEPRSPLEGPDP
AELLLMGSYLGKPGPPQPVPAPEARDLLERPGRRCASARAASPAHSAHRAHHIHPSLPTP
LLRPSRRPSHRDCGTLSNRFVITPRRRYPIQQAQYSLLGVLPTVCWNGYHKKTVLSARNS
KMVCSPVTVRIAPPDSKLARSPIPEQIINSTLSSPSNNAPDPCAKETVLSALKERKKRTV
EEEDQIFFDSQENKRRRHDSSGSGHSAFEPLVANGVPAAFVPKPGSLKRGLNSQSSDDHL
NKRSRTSSMSSLTSTYTGGIPSSSRNAITSSYSSSRGFSQLWKRSGPSLSPFSSPASSRS
QTPERPAKKIREDELSYRSSSSTPLATDKEAQGEKAADTTTWKAQNSWSSPPTPGSSGQR
KRKIQLLPSRRGARLTLPPPPQLGYSITAEDLDLEKRASLRWFNKALEDGTDTASNSGTE
KPPTTQPSLTFTLPTTGTTASPAALPAPSPNPLLESLKKKQSSAGPPPSSESAGVATTGA
HTPPKTPSLPAPLGSSQSGPLPGTSSDSKSTAAFLGLTPAASPIPATDPTKSPPAPQAET
SAPSPTPKQSLLXGMLSTPPADPPTSTAPAVSSASPMFKPIFLSPPKSENEGPLPSSPSK
VTTATPSGSALPAPASSPKLTFEPIFGSIGPPTSVPSSVPFFSQTAVPATATSTPLFTGQ
AGATSAVAPTSTASTSTDSASKPTFSFGVSSVTSTTTSAAQPFLFGAPPASGASFTPAVG
SIFQFGKSSAVPASTGATTQTTSGGTGSSVFGSTTLAPFTFGGSAGPAGGGGFGINAATP
GTSSASGAFSFGTGQSGTAGGTTPFGGGLSQSTLGAPSQSTPFAFSVASAPESKPVFGGT
STPTFGQNTPAPGVGASGSGLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKTPGARQR
LQARRQHTRKK
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctggcggaggggagcggcggcggccgatagcgagcgcc
agggacggccggggccggagcgggggctgcggtgggtcggccggggcggcgctccttggc
ttgtcgctgttcggcctcgtgctgtacctggtgccggcggcggcggcgctggcctggctg
gccngtggggccaccgcggcctggtggggactgagccgcgagccccgaggttcgcgcgcc
ctctcctcgctcgttcggagcgcgcggcgtcagcgagcactgcacgcttcgcctccggcc
aagtcggcggtgaacggaagtctcctagagccgcggagcccgctcgaaggacccgacccg
gccgaactgctcctcatgggcagttacctgggcaagcccggccccccgcagcctgtcccc
gccccggaggccagggacctgctggagaggcctggccgccgctgcgcgtccgcgcgcgcc
gcgtcgccagcgcactcggcgcatcgcgctcaccacattcacccttctctccccactcct
cttctccgaccctcgaggaggccttcccaccgggattgtgggactttatcaaaccggttt
gtcataacacctcgaagacgatacccaatccagcaggcccaatattcccttctgggggta
cttcctacagtgtgctggaatggttatcacaagaagactgtgctatctgctcgtaattcc
aaaatggtgtgcagcccagtgacagtgaggattgctcctccggatagtaaattggctcgt
tcgccaataccagagcagataatcaactccacactgtcctcaccatcaaataatgcccca
gacccatgtgcaaaggaaactgtactgagtgccctcaaggagagaaagaaaaggacggtg
gaggaagaagaccaaatattttttgatagccaggaaaataaaagaaggcgccatgatagc
agtgggagtggacattcagcatttgagcccctggtggctaatggagttcctgctgctttt
gtgcctaagcctggctctctgaaaagaggtctcaattcccagagctcagatgaccacttg
aataagagatcccgcacctcttccatgagctccttgacaagcacgtacacaggtggcatc
cctagctccagccgcaacgccattaccagttcttacagttcttctcgaggtttctctcag
ctttggaagagaagtgggcccagcttgtcaccgttctccagcccagcctcatcccgctcg
cagacaccagagaggccagcaaagaaaataagagaggacgagctttcttaccgctccagt
tcttcaactcctttggcaacagacaaggaggcccagggagaaaaggctgcagatacaacc
acatggaaggcgcagaactcgtggagctcccctcccacacccggcagctctgggcagcgg
aagcgaaagattcagctcctaccctcccggcgaggggctcggctgaccctgcccccacct
ccccagcttggctactccatcactgccgaagatctagatttggaaaaaagagcttcgctg
cggtggtttaacaaggccttggaggatgggactgatacggcttctaactctggcaccgag
aagccccctactactcaaccttctttgacgtttaccctgccaactactgggaccaccgcc
tccccagccgccctcccagccccaagccccaacccgctgttggagagcttgaagaagaag
cagagttctgcaggcccgcccccttcctcggaatctgctggagtggcaaccactggggcc
cacacacctccgaagacacccagccttccggcccctcttgggtcttcacagtcgggaccc
cttccgggcacctcctcggactccaaatccacagccgctttcttagggctgacccctgct
gcttccccgatcccagccactgaccccaccaagtcccctccagctcctcaggctgagaca
tcggccccgtctcccaccccgaagcaaagtcttcttntgggaatgctgagcaccccacct
gccgacccccctacctccacagcccccgctgtgtcctcggcatctcccatgttcaagccc
atctttctgtccccaccaaaaagcgagaatgagggccctttgccatccagcccatccaag
gtcaccaccgcgaccccttccggctctgccctccctgcgcctgccagcagccccaagctc
actttcgagccgatcttcggcagcatcgggccccctacgtctgtgccctcatcggtcccc
ttcttcagtcagacggccgttccagccactgccacgagtacccctcttttcaccggccag
gccggtgccacctcagccgtggctcccacgagtacagccagcacgtccacagactctgct
tcgaagcccacgttcagctttggtgtgagcagcgtgaccagcaccaccacttccgctgcc
cagcctttcctcttcggggctccccctgcctccggtgccagcttcaccccggccgtgggc
tctatattccagttcggcaaatcttctgccgtgcccgcctcgacgggagctacgacccag
accaccagcggcgggaccggtagctccgtgttcggcagcacgacgctggcgcctttcacg
ttcgggggctcggccggcccggccggcggcgggggcttcgggatcaacgcggccaccccc
ggcaccagctctgcttctggagcgttcagcttcggcacaggacagagcgggaccgctggc
ggcacgacgcctttcggaggaggcttgagtcagagcacgttgggcgcacccagccagagc
acaccctttgccttcagtgtggcgagcgcgcccgagagcaagcccgtgttcggaggcact
tccacacccacttttggtcagaacacccctgcccccggggtgggcgcatcgggcagtggt
ctctcctttggggcgtcctcaacacccacccaaggctttgttggagtcggaccttttgga
tcggcggccccttcattttccattggtgcaggatccaagaccccgggggctcggcagcga
ctgcaggcccgcaggcagcacacccgcaagaaatag

DBGET integrated database retrieval system