KEGG   Felis catus (domestic cat): 101092160Help
Entry
101092160         CDS       T02385                                 

Gene name
POM121
Definition
POM121 transmembrane nucleoporin
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:fca03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E3
AA seq 527 aa AA seqDB search
MVCSPVTVRIAPPDSKLARSPIPEQIINSTLSSPSNNAPDPCAKETVLSALKERKKRTVE
EEDQIFFDSQENKRRRHDSSGSGHSAFEPLVANGVPAAFVPKPGSLKRGLNSQSSDDHLN
KRSRTSSMSSLTSTYTGGIPSSSRNAITSSYSSSRGFSQLWKRSGPSLSPFSSPASSRSQ
TPERPAKKIREDELSYRSSSSTPLATDKEAQGEKAADTTTWKAQNSWSSPPTPGSSGQRK
RKIQLLPSRRGARLTLPPPPQLGYSITAEDLDLEKRASLRWFNKALEDGTDTASNSGTEK
PPTTQPSLTFTLPTTGTTASPAALPAPSPNPLLESLKKKQSSAGPPPSSXFGATTQTTSG
GTGSSVFGSTTLAPFTFGGSAGPAGGGGFGINAATPGTSSASGAFSFGTGQSGTAGGTTP
FGGGLSQSTLGAPSQSTPFAFSVASAPESKPVFGGTSTPTFGQNTPAPGVGASGSGLSFG
ASSTPTQGFVGVGPFGSAAPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcagcccagtgacagtgaggattgctcctccggatagtaaattggctcgttcg
ccaataccagagcagataatcaactccacactgtcctcaccatcaaataatgccccagac
ccatgtgcaaaggaaactgtactgagtgccctcaaggagagaaagaaaaggacggtggag
gaagaagaccaaatattttttgatagccaggaaaataaaagaaggcgccatgatagcagt
gggagtggacattcagcatttgagcccctggtggctaatggagttcctgctgcttttgtg
cctaagcctggctctctgaaaagaggtctcaattcccagagctcagatgaccacttgaat
aagagatcccgcacctcttccatgagctccttgacaagcacgtacacaggtggcatccct
agctccagccgcaacgccattaccagttcttacagttcttctcgaggtttctctcagctt
tggaagagaagtgggcccagcttgtcaccgttctccagcccagcctcatcccgctcgcag
acaccagagaggccagcaaagaaaataagagaggacgagctttcttaccgctccagttct
tcaactcctttggcaacagacaaggaggcccagggagaaaaggctgcagatacaaccaca
tggaaggcgcagaactcgtggagctcccctcccacacccggcagctctgggcagcggaag
cgaaagattcagctcctaccctcccggcgaggggctcggctgaccctgcccccacctccc
cagcttggctactccatcactgccgaagatctagatttggaaaaaagagcttcgctgcgg
tggtttaacaaggccttggaggatgggactgatacggcttctaactctggcaccgagaag
ccccctactactcaaccttctttgacgtttaccctgccaactactgggaccaccgcctcc
ccagccgccctcccagccccaagccccaacccgctgttggagagcttgaagaagaagcag
agttctgcaggcccgcccccttcctcggnnttcggagctacgacccagaccaccagcggc
gggaccggtagctccgtgttcggcagcacgacgctggcgcctttcacgttcgggggctcg
gccggcccggccggcggcgggggcttcgggatcaacgcggccacccccggcaccagctct
gcttctggagcgttcagcttcggcacaggacagagcgggaccgctggcggcacgacgcct
ttcggaggaggcttgagtcagagcacgttgggcgcacccagccagagcacaccctttgcc
ttcagtgtggcgagcgcgcccgagagcaagcccgtgttcggaggcacttccacacccact
tttggtcagaacacccctgcccccggggtgggcgcatcgggcagtggtctctcctttggg
gcgtcctcaacacccacccaaggctttgttggagtcggaccttttggatcggcggcccct
tcattttccattggtgcaggatccaagaccccgggggctcggcagcgactgcaggcccgc
aggcagcacacccgcaagaaatag

DBGET integrated database retrieval system