KEGG   Felis catus (domestic cat): 101092160Help
Entry
101092160         CDS       T02385                                 

Gene name
POM121C, POM121
Definition
POM121 transmembrane nucleoporin C
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101092160 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E3
AA seq 832 aa AA seqDB search
MSPAAAAAGGGERRRPIASARDGRGRSGGCGGSAGAALLGLSLFGLVLYLVPAAAALAWL
AXGATAAWWGLSREPRGSRALSSLVRSARRQRALHASPPAKSAVNGSLLEPRSPLEGPDP
AELLLMGSYLGKPGPPQPVPAPEARDLLERPGRRCASARAASPAHSAHRAHHIHPSLPTP
LLRPSRRPSHRDCGTLSNRFVITPRRRYPIQQAQYSLLGVLPTVCWNGYHKKTVLSARNS
KMVCSPVTVRIAPPDSKLARSPIPEQIINSTLSSPSNNAPDPCAKETVLSALKERKKRTV
EEEDQIFFDSQENKRRRHDSSGSGHSAFEPLVANGVPAAFVPKPGSLKRGLNSQSSDDHL
NKRSRTSSMSSLTSTYTGGIPSSSRNAITSSYSSSRGFSQLWKRSGPSLSPFSSPASSRS
QTPERPAKKIREDELSYRSSSSTPLATDKEAQGEKAADTTTWKAQNSWSSPPTPGSSGQR
KRKIQLLPSRRGARLTLPPPPQLGYSITAEDLDLEKRASLRWFNKALEDGTDTASNSGTE
KPPTTQPSLTFTLPTTGTTASPAALPAPSPNPLLESLKKKQSSAGPPPSSESAGVATTGA
HTPPKTPSLPAPLGSSQSGPLPGTSSDSKSTAAFLGLTPAASPIPATDPTKSPPAPGATT
QTTSGGTGSSVFGSTTLAPFTFGGSAGPAGGGGFGINAATPGTSSASGAFSFGTGQSGTA
GGTTPFGGGLSQSTLGAPSQSTPFAFSVASAPESKPVFGGTSTPTFGQNTPAPGVGASGS
GLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctggcggaggggagcggcggcggccgatagcgagcgcc
agggacggccggggccggagcgggggctgcggtgggtcggccggggcggcgctccttggc
ttgtcgctgttcggcctcgtgctgtacctggtgccggcggcggcggcgctggcctggctg
gccngtggggccaccgcggcctggtggggactgagccgcgagccccgaggttcgcgcgcc
ctctcctcgctcgttcggagcgcgcggcgtcagcgagcactgcacgcttcgcctccggcc
aagtcggcggtgaacggaagtctcctagagccgcggagcccgctcgaaggacccgacccg
gccgaactgctcctcatgggcagttacctgggcaagcccggccccccgcagcctgtcccc
gccccggaggccagggacctgctggagaggcctggccgccgctgcgcgtccgcgcgcgcc
gcgtcgccagcgcactcggcgcatcgcgctcaccacattcacccttctctccccactcct
cttctccgaccctcgaggaggccttcccaccgggattgtgggactttatcaaaccggttt
gtcataacacctcgaagacgatacccaatccagcaggcccaatattcccttctgggggta
cttcctacagtgtgctggaatggttatcacaagaagactgtgctatctgctcgtaattcc
aaaatggtgtgcagcccagtgacagtgaggattgctcctccggatagtaaattggctcgt
tcgccaataccagagcagataatcaactccacactgtcctcaccatcaaataatgcccca
gacccatgtgcaaaggaaactgtactgagtgccctcaaggagagaaagaaaaggacggtg
gaggaagaagaccaaatattttttgatagccaggaaaataaaagaaggcgccatgatagc
agtgggagtggacattcagcatttgagcccctggtggctaatggagttcctgctgctttt
gtgcctaagcctggctctctgaaaagaggtctcaattcccagagctcagatgaccacttg
aataagagatcccgcacctcttccatgagctccttgacaagcacgtacacaggtggcatc
cctagctccagccgcaacgccattaccagttcttacagttcttctcgaggtttctctcag
ctttggaagagaagtgggcccagcttgtcaccgttctccagcccagcctcatcccgctcg
cagacaccagagaggccagcaaagaaaataagagaggacgagctttcttaccgctccagt
tcttcaactcctttggcaacagacaaggaggcccagggagaaaaggctgcagatacaacc
acatggaaggcgcagaactcgtggagctcccctcccacacccggcagctctgggcagcgg
aagcgaaagattcagctcctaccctcccggcgaggggctcggctgaccctgcccccacct
ccccagcttggctactccatcactgccgaagatctagatttggaaaaaagagcttcgctg
cggtggtttaacaaggccttggaggatgggactgatacggcttctaactctggcaccgag
aagccccctactactcaaccttctttgacgtttaccctgccaactactgggaccaccgcc
tccccagccgccctcccagccccaagccccaacccgctgttggagagcttgaagaagaag
cagagttctgcaggcccgcccccttcctcggaatctgctggagtggcaaccactggggcc
cacacacctccgaagacacccagccttccggcccctcttgggtcttcacagtcgggaccc
cttccgggcacctcctcggactccaaatccacagccgctttcttagggctgacccctgct
gcttccccgatcccagccactgaccccaccaagtcccctccagctcctggagctacgacc
cagaccaccagcggcgggaccggtagctccgtgttcggcagcacgacgctggcgcctttc
acgttcgggggctcggccggcccggccggcggcgggggcttcgggatcaacgcggccacc
cccggcaccagctctgcttctggagcgttcagcttcggcacaggacagagcgggaccgct
ggcggcacgacgcctttcggaggaggcttgagtcagagcacgttgggcgcacccagccag
agcacaccctttgccttcagtgtggcgagcgcgcccgagagcaagcccgtgttcggaggc
acttccacacccacttttggtcagaacacccctgcccccggggtgggcgcatcgggcagt
ggtctctcctttggggcgtcctcaacacccacccaaggctttgttggagtcggacctttt
ggatcggcggccccttcattttccattggtgcaggatccaagaccccgggggctcggcag
cgactgcaggcccgcaggcagcacacccgcaagaaatag

DBGET integrated database retrieval system