KEGG   Felis catus (domestic cat): 101092160Help
Entry
101092160         CDS       T02385                                 

Gene name
POM121C
Definition
(RefSeq) nuclear envelope pore membrane protein POM 121C isoform X1
  KO
K14316  
nuclear pore complex protein Nup121
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101092160 (POM121C)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     101092160 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
E3
AA seq 1076 aa AA seqDB search
MGSYLGKPGPPQPVPAPEARDLLERPGRRCASARAASPAHSAHRAHHIHPSLPTPLLRPS
RRPSHRDCGTLSNRFVITPRRRYPIQQAQYSLLGVLPTVCWNGYHKKTVLSARNSKMVCS
PVTVRIAPPDSKLARSPIPEQIINSTLSSPSNNAPDPCAKETVLSALKERKKRTVEEEDQ
IFFDSQENKRRRHDSSGSGHSAFEPLVANGVPAAFVPKPGSLKRGLNSQSSDDHLNKRSR
TSSMSSLTSTYTGGIPSSSRNAITSSYSSSRGFSQLWKRSGPSLSPFSSPASSRSQTPER
PAKKIREDELSYRSSSSTPLATDKEAQGEKAADTTTWKAQNSWSSPPTPGSSGQRKRKIQ
LLPSRRGARLTLPPPPQLGYSITAEDLDLEKRASLRWFNKALEDGTDTASNSGTEKPPTT
QPSLTFTLPTTGTTASPAALPAPSPNPLLESLKKKQSSAGPPPSSESAGVATTGAHTPPK
TPSLPAPLGSSQSGPLPGTSSDSKSTAAFLGLTPAASPIPATDPTKSPPAPQAETSAPSP
TPKQSLLLGMLSTPPADPPTSTAPAVSSASPMFKPIFLSPPKSENEGPLPSSPSKVTTAT
PSGSALPAPASSPKLTFEPIFGSIGPPTSVPSSVPFFSQTAVPATATSTPLFTGQAGATS
AVAPTSTASTSTDSASKPTFSFGVSSVTSTTTSAAQPFLFGAPPASGASFTPAVGSIFQF
GKSSAVPASTTVTTFVQSLPGAVPTTASGSGTTGFGGFGGGLSTPAPVTSSQPAPTFTSA
ATPAFHIPFGSSTKPPLSSYPGANPQPTFGAADGQQQGAAKPALAPSFGSSFAFGNSAAA
APAATPAPGPAQPAFGGTTPSGFGGLKPTASAFGAPASTQPAFGSGTSVFSFGAAAASGF
GATTQTTSGGTGSSVFGSTTLAPFTFGGSAGPAGGGGFGINAATPGTSSASGAFSFGTGQ
SGTAGGTTPFGGGLSQSTLGAPSQSTPFAFSVASAPESKPVFGGTSTPTFGQNTPAPGVG
ASGSGLSFGASSTPTQGFVGVGPFGSAAPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgggcagttacctgggcaagcccggccccccgcagcctgtccccgccccggaggccagg
gacctgctggagaggcctggccgccgctgcgcgtccgcgcgcgccgcgtcgccagcgcac
tcggcgcatcgcgctcaccacattcacccttctctccccactcctcttctccgaccctcg
aggaggccttcccaccgggattgtgggactttatcaaaccggtttgtcataacacctcga
agacgatacccaatccagcaggcccaatattcccttctgggggtacttcctacagtgtgc
tggaatggttatcacaagaagactgtgctatctgctcgtaattccaaaatggtgtgcagc
ccagtgacagtgaggattgctcctccggatagtaaattggctcgttcgccaataccagag
cagataatcaactccacactgtcctcaccatcaaataatgccccagacccatgtgcaaag
gaaactgtactgagtgccctcaaggagagaaagaaaaggacggtggaggaagaagaccaa
atattttttgatagccaggaaaataaaagaaggcgccatgatagcagtgggagtggacat
tcagcatttgagcccctggtggctaatggagttcctgctgcttttgtgcctaagcctggc
tctctgaaaagaggtctcaattcccagagctcagatgaccacttgaataagagatcccgc
acctcttccatgagctccttgacaagcacgtacacaggtggcatccctagctccagccgc
aacgccattaccagttcttacagttcttctcgaggtttctctcagctttggaagagaagt
gggcccagcttgtcaccgttctccagcccagcctcatcccgctcgcagacaccagagagg
ccagcaaagaaaataagagaggacgagctttcttaccgctccagttcttcaactcctttg
gcaacagacaaggaggcccagggagaaaaggctgcagatacaaccacatggaaggcgcag
aactcgtggagctcccctcccacacccggcagctctgggcagcggaagcgaaagattcag
ctcctaccctcccggcgaggggctcggctgaccctgcccccacctccccagcttggctac
tccatcactgccgaagatctagatttggaaaaaagagcttcgctgcggtggtttaacaag
gccttggaggatgggactgatacggcttctaactctggcaccgagaagccccctactact
caaccttctttgacgtttaccctgccaactactgggaccaccgcctccccagccgccctc
ccagccccaagccccaacccgctgttggagagcttgaagaagaagcagagttctgcaggc
ccgcccccttcctcggaatctgctggagtggcaaccactggggcccacacacctccgaag
acacccagccttccggcccctcttgggtcttcacagtcgggaccccttccgggcacctcc
tcggactccaaatccacagccgctttcttagggctgacccctgctgcttccccgatccca
gccactgaccccaccaagtcccctccagctcctcaggctgagacatcggccccgtctccc
accccgaagcaaagtcttcttttgggaatgctgagcaccccacctgccgacccccctacc
tccacagcccccgctgtgtcctcggcatctcccatgttcaagcccatctttctgtcccca
ccaaaaagcgagaatgagggccctttgccatccagcccatccaaggtcaccaccgcgacc
ccttccggctctgccctccctgcgcctgccagcagccccaagctcactttcgagccgatc
ttcggcagcatcgggccccctacgtctgtgccctcatcggtccccttcttcagtcagacg
gccgttccagccactgccacgagtacccctcttttcaccggccaggccggtgccacctca
gccgtggctcccacgagtacagccagcacgtccacagactctgcttcgaagcccacgttc
agctttggtgtgagcagcgtgaccagcaccaccacttccgctgcccagcctttcctcttc
ggggctccccctgcctccggtgccagcttcaccccggccgtgggctctatattccagttc
ggcaaatcttctgccgtgcccgcctcgacgacggtcacaacctttgtccagtccctcccc
ggggccgtgccgacgaccgccagcggcagcggcaccaccggcttcggcggtttcggcggc
ggcctcagcacccccgccccggtcaccagcagccagccggcgccaaccttcactagcgcc
gccaccccggcgttccacattcccttcggctcgagcaccaagccccccctctcttcgtac
ccgggagccaacccccagcccacgttcggggccgccgacgggcagcagcagggcgccgcc
aagccggccctcgccccgagcttcggcagctctttcgctttcgggaactctgcggccgca
gccccggctgcgaccccagcgcccggcccggcccagcccgccttcggcggcaccacgccg
tccggcttcggcggtttgaagcccacggcgtctgccttcggcgcccccgccagcacccag
ccggccttcggcagcggcacatctgtgttctcctttggggcggccgccgcctctggcttc
ggagctacgacccagaccaccagcggcgggaccggtagctccgtgttcggcagcacgacg
ctggcgcctttcacgttcgggggctcggccggcccggccggcggcgggggcttcgggatc
aacgcggccacccccggcaccagctctgcttctggagcgttcagcttcggcacaggacag
agcgggaccgctggcggcacgacgcctttcggaggaggcttgagtcagagcacgttgggc
gcacccagccagagcacaccctttgccttcagtgtggcgagcgcgcccgagagcaagccc
gtgttcggaggcacttccacacccacttttggtcagaacacccctgcccccggggtgggc
gcatcgggcagtggtctctcctttggggcgtcctcaacacccacccaaggctttgttgga
gtcggaccttttggatcggcggccccttcattttccattggtgcaggatccaagaccccg
ggggctcggcagcgactgcaggcccgcaggcagcacacccgcaagaaatag

DBGET integrated database retrieval system