KEGG   Felis catus (domestic cat): 101092384Help
Entry
101092384         CDS       T02385                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101092384 (CLK1)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   101092384 (CLK1)
Spliceosome [BR:fca03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    101092384 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C1
AA seq 484 aa AA seqDB search
MRHSKRTYCPDWEEKDWDCGKWRSSSSHKRKKRSHSSARENKHCKYNHSKTSDSHYVENR
SINEKDYHSRRYIDEYRNDYSQGCEPGHRHRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHHRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPSSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKMKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIEKMLQYDPAKRITLREALKHPFFHPL
RKDT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacactcgaagagaacttattgccctgattgggaggaaaaagattgggactgtgga
aaatggagaagcagcagcagtcataaaagaaagaagagatcacatagcagtgcccgggag
aataagcactgcaaatataatcactctaaaacatctgatagccattatgtggaaaacagg
tccataaatgagaaagattatcatagtcgacgctacattgatgaatacagaaatgactac
agtcaaggatgtgaacctggacatcgccatagagaccatgaaagcagataccagaaccat
agtagcaagtcttctggtagaagtggaagaagtagttataaaagcaaacataggattcac
catagtacttcacaccatcgttcacatgggaagagtcaccgaaggaaaagaaccaggagt
gtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaaga
tatgaaattgttgatactttaggagaaggagcttttggaaaagtcgtggagtgcattgat
cataaagcaggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatactgt
gaagctgctcgctcagaaatacaagttttggaacacttgaatacaacagaccccagcagt
acattccgctgtgtccagatgttggagtggtttgagcatcatggtcatatttgcattgta
tttgaactactaggacttagtacttatgacttcattaaggaaaatggttttctaccattt
cgtctggatcatatcaggaagatggcatatcagatatgcaagtccgtgaattttctgcac
agtaataagttgactcacacagacttaaagcctgaaaacatcttatttgtgcagtctgac
tacacagaggcatataatcccaaaatgaaacgtgatgaacgtaccttaataaatccagat
attaaagttgtagactttggaagtgcaacatatgatgatgaacatcacagtacattggta
tctacaaggcattatagggcacctgaagttattttagccctgggatggtcccagccatgt
gatgtctggagtataggatgtattcttattgaatactaccttgggtttacagtatttcca
acacatgatagtaaggagcatttggcaatgatggaaagaattcttggacctttaccaaaa
catatgatacagaaaacgaggaaacgtaaatatttccatcatgatcgattagactgggat
gaacacagttctgctggcagatatgtttcaaggcgctgtaaacctctgaaggaatttatg
ctctctcaggatgctgaacatgaacttctctttgacctcattgagaaaatgttacagtat
gatccagctaaaaggattactctcagagaagccttaaagcatcctttctttcaccccctg
agaaaagatacatag

DBGET integrated database retrieval system