KEGG   Felis catus (domestic cat): 101092550Help
Entry
101092550         CDS       T02385                                 

Definition
(RefSeq) glutathione S-transferase theta-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00480  Glutathione metabolism
fca00980  Metabolism of xenobiotics by cytochrome P450
fca00982  Drug metabolism - cytochrome P450
fca00983  Drug metabolism - other enzymes
fca01524  Platinum drug resistance
fca05200  Pathways in cancer
fca05204  Chemical carcinogenesis
fca05225  Hepatocellular carcinoma
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101092550
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101092550
   00982 Drug metabolism - cytochrome P450
    101092550
   00983 Drug metabolism - other enzymes
    101092550
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101092550
   05204 Chemical carcinogenesis
    101092550
   05225 Hepatocellular carcinoma
    101092550
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101092550
  Drug resistance
   01524 Platinum drug resistance
    101092550
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101092550
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   101092550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 101092550
NCBI-ProteinID: XP_006938700
Ensembl: ENSFCAG00000022320
UniProt: M3X9J9
Position
D3
AA seq 242 aa AA seqDB search
MPLELFLDLYSPPCRAIYIFAKKNGIPFEFRPVELGRGEHLKPEFLKVNPLGKVPALRDG
DFLLAESVAILLYLSRKYQTAPYWYPPDLQARARVDEYLAWQHTAIQLPATNVYLCKSLL
PHFLGQPVDTVCLDRLLGKLKPALQHLDQEVLAAKPFLATEQVSLADLMAFTELMQPTAV
GCDLFRDWSRLAAWRARVEAALGPELVQDAHKLVLQPRDPRDAQQDPRLAQELVHRLQER
LS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggagctgtttctggacctgtactcgcccccctgccgtgccatttacattttc
gccaagaagaatggcattccctttgagtttcggcctgtggagctgggacgaggggagcac
ctgaagcctgaattcttgaaggtgaaccccctggggaaggtgcctgccctgagggatgga
gacttcctgttggcggagagtgtggccatccttttatacttgagccgcaagtaccagacg
gcgccatactggtatccacctgacctgcaggcccgcgcccgagtcgacgagtacttggcg
tggcagcacacggccatccagctgcctgccaccaatgtctacctgtgtaagtccctcctg
ccccacttcttggggcagcctgtggacaccgtgtgcctagaccggctgttggggaagctg
aaaccagccctgcagcacctggatcaggaggtcctggcggccaaacccttcctggctacc
gagcaggtctccctagcagatctgatggcattcacggagctgatgcagcccactgctgtt
ggctgcgacctcttccgagactggtcccggctggcagcctggcgagcccgagtagaggct
gccctgggccctgagcttgtccaagatgcgcacaagcttgtgctacagccgcgggacccc
agagacgcccagcaggacccccggctggcacaggagctggtgcatcggctgcaggagcgg
ctcagttga

DBGET integrated database retrieval system