KEGG   Felis catus (domestic cat): 101092671Help
Entry
101092671         CDS       T02385                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101092671 (BAP1)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101092671 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 750 aa AA seqDB search
MQEGAGRAGGWGGRVGPKRACLTTSPLLLSPHPGLFTLLVEDFGVKGVQVEEIYDLQSKC
QGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSV
LLNCSNVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGL
SAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATA
GEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQEP
QLPEESKPASSKSPLALEAGRAPAASEGIHTDGVEDVAGSCPQAPSHSPPSKPKLVVKPP
GSSLNGVPPNPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRAPVRPPQQYSDDED
DYEDDEDDDVQNTNSAIRYKRKGPGKPGPLSGSGDGQLSVLQPNTINVLAEKLKESQKDL
SIPLSIKTSSGAASPAVAVPTHPQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRP
SSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTECG
KGSSPCSRPSQGSQGSSSPEEKEVVESADGREKPGLARPGEPLSGEKYSPKELLALLKCV
EAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVR
RRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagggtgccgggcgggccgggggctggggaggccgggtgggcccgaaacgcgcc
tgcctgaccaccagcccgctcctcttgtcgccccacccaggcctcttcaccctcctggtg
gaagatttcggtgtcaaaggggtgcaggtggaagagatctatgaccttcagagcaaatgc
cagggcccagtgtatggattcatcttcctgttcaaatggatcgaagagcgccgatcccgt
cgcaaggtctctaccttggtggatgatacgtctgtgattgatgatgatattgtgaataac
atgttctttgcccatcagctgatccccaactcttgtgccactcatgccctgctgagcgtg
ctcctgaactgcagcaatgtggacctgggtcccaccctgagtcgcatgaaggatttcacc
aaaggcttcagccctgagagcaaaggatatgcgattggcaatgccccagagttggccaaa
gcacataatagccatgccaggcctgagccacgccacctccctgagaagcagaatggcctt
agtgcagtgcggaccatggaggcattccactttgtcagctatgtgcctatcacaggccgg
ctttttgagctggatgggctgaaggtctaccccattgaccatgggccctggggggaggat
gaggagtggacagacaaggcccggcgggtcatcatggagcgtatcggcctcgccaccgca
ggggagccctaccatgacatccgcttcaacctgatggcggtggtgcccgaccgcaggatc
aagtatgaggccaggctgcatgtgctaaaggtgaaccgtcagacagtactggaggccctg
cagcagctgattagggtgacgcagccagagctgattcagacccacaagtctcaagagcca
cagctgcctgaggagtccaaaccagccagcagcaagtcccctctggcgctggaggcaggc
agggccccagcagcctctgagggcattcacacagatggtgtggaggacgtggctggttca
tgcccccaggccccaagccacagccctcccagcaaacctaagctggtggtgaagcctcca
gggagcagcctcaacggggttcctcccaaccccactcccattgttcagcggctgccggcc
tttctggacaatcacaactatgccaagtcccccatgcaggaggaggaagacctggcagca
ggtgtgggccgcagccgagctccagtccgcccgccccagcagtactcagatgatgaggac
gactacgaggatgatgaggacgacgatgtgcagaacaccaactctgccatcaggtacaag
cgaaaggggccagggaagccaggaccactgagcggctctggggacgggcagctgtcagtg
ctgcagcccaacaccatcaatgtcttggccgaaaagctcaaagagtcccagaaagacctc
tcaattcctctgtccatcaagaccagcagcggggccgcgagcccagccgtggcggttcct
acacacccgcagccctcgcccacccccagcaacgagagcacggacacagcctccgagatc
ggcagtgctttcaactcgcctctgcggtcgcccattcgctcagctaacccgacgcggccc
tccagccctgtcacctcccacatctccaaggtgctttttggagaggatgacagcttgctg
cgtgttgactgcatccgctacaatcgtgctgtacgagacctgggtcctgtcatcagcaca
ggcctgctgcatctcgctgaggatggtgtgctgagtcctctggcactgacagagtgtggg
aagggttcctcgccctgcagcagaccaagccaaggcagccagggctccagcagcccagaa
gagaaggaggtggtggaatctgcagacggcagagagaagcctgggttggccaggcccggt
gagcccttgagcggggagaagtactcacccaaggagctgctggcactgttgaagtgtgtg
gaagcagagatcgcaaactatgaggcctgcctcaaggaggaagtggagaagaggaagaag
ttcaagattgacgaccagagaaggacccacaactacgatgagttcatctgtaccttcatc
tccatgctggcccaggaaggcatgctggccaacctggtggaacagaacatctcggtgcgg
cggcgccaaggggtcagcatcggccggctccacaagcagcggaaacctgaccggcggaaa
cgctcgcgcccttacaaggccaagcgccagtga

DBGET integrated database retrieval system