KEGG   Felis catus (domestic cat): 101092671Help
Entry
101092671         CDS       T02385                                 

Gene name
BAP1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase BAP1 isoform X1
  KO
K08588  ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101092671 (BAP1)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101092671 (BAP1)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    101092671 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 101092671
NCBI-ProteinID: XP_023105232
Ensembl: ENSFCAG00000015711
Position
A2
AA seq 729 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQEPQLPEESKPASSKSPLALEAGR
APAASEGIHTDGVEDVAGSCPQAPSHSPPSKPKLVVKPPGSSLNGVPPNPTPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRAPVRPPQQYSDDEDDYEDDEDDDVQNTNSAIRYKR
KGPGKPGPLSGSGDGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAASPAVAVPT
HPQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTECGKGSSPCSRPSQGSQGSSSPEE
KEVVESADGREKPGLARPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagcgaccctggcctcttcaccctcctggtggaa
gatttcggtgtcaaaggggtgcaggtggaagagatctatgaccttcagagcaaatgccag
ggcccagtgtatggattcatcttcctgttcaaatggatcgaagagcgccgatcccgtcgc
aaggtctctaccttggtggatgatacgtctgtgattgatgatgatattgtgaataacatg
ttctttgcccatcagctgatccccaactcttgtgccactcatgccctgctgagcgtgctc
ctgaactgcagcaatgtggacctgggtcccaccctgagtcgcatgaaggatttcaccaaa
ggcttcagccctgagagcaaaggatatgcgattggcaatgccccagagttggccaaagca
cataatagccatgccaggcctgagccacgccacctccctgagaagcagaatggccttagt
gcagtgcggaccatggaggcattccactttgtcagctatgtgcctatcacaggccggctt
tttgagctggatgggctgaaggtctaccccattgaccatgggccctggggggaggatgag
gagtggacagacaaggcccggcgggtcatcatggagcgtatcggcctcgccaccgcaggg
gagccctaccatgacatccgcttcaacctgatggcggtggtgcccgaccgcaggatcaag
tatgaggccaggctgcatgtgctaaaggtgaaccgtcagacagtactggaggccctgcag
cagctgattagggtgacgcagccagagctgattcagacccacaagtctcaagagccacag
ctgcctgaggagtccaaaccagccagcagcaagtcccctctggcgctggaggcaggcagg
gccccagcagcctctgagggcattcacacagatggtgtggaggacgtggctggttcatgc
ccccaggccccaagccacagccctcccagcaaacctaagctggtggtgaagcctccaggg
agcagcctcaacggggttcctcccaaccccactcccattgttcagcggctgccggccttt
ctggacaatcacaactatgccaagtcccccatgcaggaggaggaagacctggcagcaggt
gtgggccgcagccgagctccagtccgcccgccccagcagtactcagatgatgaggacgac
tacgaggatgatgaggacgacgatgtgcagaacaccaactctgccatcaggtacaagcga
aaggggccagggaagccaggaccactgagcggctctggggacgggcagctgtcagtgctg
cagcccaacaccatcaatgtcttggccgaaaagctcaaagagtcccagaaagacctctca
attcctctgtccatcaagaccagcagcggggccgcgagcccagccgtggcggttcctaca
cacccgcagccctcgcccacccccagcaacgagagcacggacacagcctccgagatcggc
agtgctttcaactcgcctctgcggtcgcccattcgctcagctaacccgacgcggccctcc
agccctgtcacctcccacatctccaaggtgctttttggagaggatgacagcttgctgcgt
gttgactgcatccgctacaatcgtgctgtacgagacctgggtcctgtcatcagcacaggc
ctgctgcatctcgctgaggatggtgtgctgagtcctctggcactgacagagtgtgggaag
ggttcctcgccctgcagcagaccaagccaaggcagccagggctccagcagcccagaagag
aaggaggtggtggaatctgcagacggcagagagaagcctgggttggccaggcccggtgag
cccttgagcggggagaagtactcacccaaggagctgctggcactgttgaagtgtgtggaa
gcagagatcgcaaactatgaggcctgcctcaaggaggaagtggagaagaggaagaagttc
aagattgacgaccagagaaggacccacaactacgatgagttcatctgtaccttcatctcc
atgctggcccaggaaggcatgctggccaacctggtggaacagaacatctcggtgcggcgg
cgccaaggggtcagcatcggccggctccacaagcagcggaaacctgaccggcggaaacgc
tcgcgcccttacaaggccaagcgccagtga

DBGET integrated database retrieval system