KEGG   Felis catus (domestic cat): 101092682Help
Entry
101092682         CDS       T02385                                 

Gene name
GK2
Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fca00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:fca03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B1
AA seq 553 aa AA seqDB search
MAAPKKAAVGPLVGAVVQGTNSTRFLVFNSKTADLLGCHQVELTQEFPKEGWVEQDPKEI
LQSVYECIERTCEKLDKLNIDISNIKAIGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQ
STVENLRKKIPENNNFVKSKTGLPLSTYFSAVKLRWILDNVRKVQKAVEEGRALFGTIDS
WLIWSLTGGVYGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDILPNVWSSSEIY
GLMKAGTLEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGHKCVFSEHGL
LTTVAYQLGRDKPACYALEGSVAIAGAVIRWLRDNIGIINTSEEIEVLARDVGTSYGCYF
VPAFSGLYAPYWEPTARGIICGLTQFINKSHIAFAALESVCFQTREILDAMNHDCGIPLR
HLQVDGKMTNNKVLMQLQADILHIPVIKPPMPETTALGAAMAAGAAEGVGVWSLKPEDLS
VVIMERFEPQIKATECEIRYSTWKKAVMKSMGWVTTQTPESSDPTIFSSLPLGXFIVSSM
VMLIGARYISGIP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccgaagaaagccgctgtggggcctttggtgggggcagtggtgcagggaact
aattccactcgctttctggttttcaattcaaaaacagcggatctacttggttgccatcaa
gtggaattaacacaagagttcccaaaagaaggatgggtagaacaagaccctaaggaaatc
cttcagtctgtctatgagtgtatagagagaacatgtgagaaacttgataaactgaacatt
gatatatccaacataaaagctattggtgtcagcaatcagagggaaaccacagtaatctgg
gacaagttaactggagagccgctctacaatgctgtggtgtggcttgatctaagaacccag
tctactgttgaaaatcttaggaagaaaattccagaaaataataactttgtcaagtccaag
acaggccttccacttagcacttacttcagtgcagtgaaacttcgttggattctcgacaat
gtgagaaaagttcaaaaggctgttgaagaaggtagagctctttttggtaccattgattca
tggcttatctggagtttgacaggaggagtatatggtggtgtccattgtacagatgtaaca
aatgcaagtaggacaatgcttttcaacatccattctttagaatgggataaagagctttgt
gacttttttgaaattccaatggacattcttccaaatgtatggagttcttctgagatctat
ggcctaatgaaagctgggaccttggaaggggtgccaatatctgggtgcttgggggaccag
tctgctgcattggtaggacaaatgtgcttccaagaaggacaagccaaaaacacgtatgga
acaggctgtttcttactgtgtaataccggtcataagtgtgtgttttctgaacatggcctt
ctgaccacagtggcttatcaactaggcagagacaagccagcgtgttatgcactggaaggt
tctgttgctatagctggcgctgttattcgctggttaagagacaatattggaattataaac
acctcagaagaaattgaagtacttgctagagatgtaggtacctcttacggctgttacttt
gtcccagctttttcagggttatatgcaccttattgggagcccactgcaagaggaataatc
tgtggtctcactcagtttatcaataaaagtcatattgcttttgctgcactagaatctgtt
tgtttccaaacccgagagattttggatgccatgaaccatgactgtggaattcccctccgt
catttgcaggtagatggaaaaatgaccaacaataaagttcttatgcaactacaagcagac
attctgcatattccagtaataaagccccctatgcccgaaacaaccgcactgggagctgcc
atggcagcaggagctgcagaaggggtgggcgtttggagtcttaaacccgaggatttgtca
gttgtcattatggaacggtttgaaccacagatcaaggccacagaatgtgaaattcgttac
tctacatggaagaaagctgtgatgaagtcaatgggttgggttacaactcagactcctgaa
agtagtgatcctactatcttctctagtttgcccttgggcnnttttatagtgagtagcatg
gtaatgctaattggagcaagatacatctcaggtataccataa

DBGET integrated database retrieval system