KEGG   Felis catus (domestic cat): 101092689Help
Entry
101092689         CDS       T02385                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04115  p53 signaling pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04350  TGF-beta signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05144  Malaria
fca05165  Human papillomavirus infection
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101092689 (THBS1)
   04350 TGF-beta signaling pathway
    101092689 (THBS1)
   04151 PI3K-Akt signaling pathway
    101092689 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101092689 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101092689 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    101092689 (THBS1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101092689 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101092689 (THBS1)
   05205 Proteoglycans in cancer
    101092689 (THBS1)
   05219 Bladder cancer
    101092689 (THBS1)
  Infectious diseases
   05165 Human papillomavirus infection
    101092689 (THBS1)
   05144 Malaria
    101092689 (THBS1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101092689 (THBS1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   101092689 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC cEGF EGF_3 EGF_CA Laminin_G_3 Laminin_G_2 EGF
Motif
Other DBs
NCBI-GeneID: 101092689
NCBI-ProteinID: XP_011281379
Ensembl: ENSFCAG00000011449
UniProt: M3WF45
Position
B3
AA seq 1170 aa AA seqDB search
MGLAWGLSVLFLLHVCGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDSSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAIERKDHSGQVFSVV
SNGKAGTLDLSLTVQGMQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLANVARLRIAKGGVNDNFQGVLQNVRFVFGTTPEAILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACRRDACPINGGWGPWSLWDICSVTCGGGVQTRSRLCNNPTPQFGGKDCVGDATENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCKDIDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGPQPFGRGVEYATANKQVCKPRNPCTDGTHDCNKN
AKCSYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENIDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactcagtgtcctcttcctgttgcatgtatgtggctccaaccgt
attccagaatccgggggagacaacagcgtgttcgacatctttgaactcacgggcgctgcc
cggaagggctctgggcgccggctggtgaaggggcctgactcttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gccgtgcgggcagagaaaggcttccttctcttggcctccctgaggcagatgaagaagacc
cgaggcacactgctggccatagaacggaaagaccactcgggccaggttttcagtgtggtc
tccaatggcaaggcgggcaccctggacctgagcctaaccgtgcaggggatgcagcatgtg
gtgtcggtggaagaagcgctcctggcgaccggccaatggaagagcatcaccctgtttgtg
caggaggacagggcccagctgtacatcgactgtgagaagatggagaacgccgagctggat
gtccccatccaaagcatcttcaccagggacctggccaacgttgccagactccgcatcgca
aaaggaggtgtcaatgacaatttccagggggtgctgcagaatgtgaggttcgtcttcgga
accacaccagaagccatcctcaggaacaaaggctgttcgagctctaccaatgttcttctc
acccttgacaacaacgtggtaaacggctccagccctgccatccggactaactacattggc
cacaagacaaaggatctgcaagccatctgtggcatttcgtgcgatgagctgtccagcatg
gtcctggagttgaggggcctgcgcaccatcgtgaccaccctccaggacagcatccgcaaa
gtgactgaagagaacaaggagttggccaatgagctaaggaggcctcccctctgctaccac
aacggagttcagtacaggaataacgaggaatggactgttgatagctgcacggagtgtcgc
tgtcagaactctgttaccatctgcaaaaaagtgtcctgccccatcatgccctgctccaat
gccacagttcccgatggagaatgctgcccacggtgttggcccagcgactctgcggatgat
ggctggtccccgtggtctgagtggacctcctgctctgtgacctgtggcaacggaatccag
cagcgcggtcgctcctgtgacagcctcaacaaccgctgcgagggctcctccgtccagact
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggcggctggagccac
tggtccccgtggtcgtcttgttctgtgacatgcggtgacggtgtgatcacaaggatccga
ctctgcaattcccctagcccccagatgaacgggaagccgtgtgaaggcgaagctcgagag
accaaggcctgcaggagagacgcgtgccccatcaatggaggctggggtccctggtcactg
tgggacatctgttctgtcacctgcggaggaggggtgcagacacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgcgacagaaaaccagatc
tgcaacaagcaggactgtccaattgacggatgcctgtccaatccctgctttgctggggtc
aagtgtaccagttaccctgacggcagctggaaatgtggtgcttgtccccccggctacagt
ggaaatggcatccaatgcaaagacatcgatgagtgcaaagaagtacctgacgcctgcttc
aaccacaacggggagcacaggtgtgagaacacggacccgggctacaactgtctgccctgc
cccccacgcttcactggcccgcagcccttcggccggggtgtggaatatgccaccgccaac
aaacaggtatgcaagccccgcaacccctgcacagatgggacacacgactgcaacaagaac
gccaagtgcagctacctgggccattacagtgaccccatgtaccgctgtgagtgcaagccc
ggctacgcaggcaatggcatcatctgcggtgaggacacggacctggacggctggcccaac
gaggacctggtgtgcgtggccaatgccacctaccactgcaaaaaggataattgccccaac
cttcccaactccgggcaggaagactatgacaaggatggaattggcgacgcctgtgatgac
gacgacgacaatgataaaatcccagatgacagggacaactgtccattccactataaccca
gcccagtatgactatgaccgggatgacgtgggagaccgctgtgacaactgcccctacaac
cacaacccagatcaggctgacacagacaacaacggggaaggagatgcctgcgccgctgac
atcgacggggatggtatcctcaatgaacgagacaactgccagtacgtctacaacgtggac
cagagggacacggatatggatggggtcggcgatcagtgtgacaactgccccctggaacac
aatccagatcagctcgactctgactcagaccgcatcggagacacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaacctggacaattgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaggacggcaagggagacgcctgcgaccatgatgatgacaac
gatggcattcctgatgatagggacaactgcagactcgtgcccaatcctgaccagaaggat
tctgacggtgacggtcgaggtgatgcttgcaaagatgattttgaccatgacaatgtgcca
gacattgatgacatctgtcccgaaaacattgatatcagtgagaccgatttccgccgattc
cagatgattcctctagatcccaaagggacgtcccaaaatgaccctaactgggtggtgcgc
catcagggtaaagaactcgtccagactgtcaactgcgatccaggacttgctgtaggttac
gatgagtttaatgcagtggacttcagtggcaccttcttcatcaacactgagagggatgat
gactatgctggatttgtgtttggctaccagtctagcagccgcttttatgtggtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccactagggctcagggatactcaggc
ctttctgtgaaagtggtgaactccacaacagggccaggcgagcacctacggaacgccctg
tggcacacgggaaacacccccggccaggtgcgcactctgtggcatgaccctcgtcacata
ggctggaaagatttcactgcctacaggtggcgtctcagccaccgaccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgattcaggacccatctacgac
aaaacctatgctggaggtagactggggttgtttgtcttctctcaagaaatggtgttcttc
tccgacctgaaatacgaatgcagagattcctaa

DBGET integrated database retrieval system