KEGG   Felis catus (domestic cat): 101092689Help
Entry
101092689         CDS       T02385                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
fca  Felis catus (domestic cat)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101092689 (THBS1)
   04350 TGF-beta signaling pathway
    101092689 (THBS1)
   04151 PI3K-Akt signaling pathway
    101092689 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101092689 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101092689 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    101092689 (THBS1)
  Cellular commiunity
   04510 Focal adhesion
    101092689 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101092689 (THBS1)
   05205 Proteoglycans in cancer
    101092689 (THBS1)
   05219 Bladder cancer
    101092689 (THBS1)
  Infectious diseases
   05144 Malaria
    101092689 (THBS1)
Heparan sulfate/heparin binding proteins [BR:fca00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  101092689 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B3
AA seq 1170 aa AA seqDB search
MGLAWGLSVLFLLHVCGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDSSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAIERKDHSGQVFSVV
SNGKAGTLDLSLTVQGMQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLANVARLRIAKGGVNDNFQGVLQNVRFVFGTTPEAILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACRRDACPINGGWGPWSLWDICSVTCGGGVQTRSRLCNNPTPQFGGKDCVGDATENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCKDIDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGPQPFGRGVEYATANKQVCKPRNPCTDGTHDCNKN
AKCSYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENIDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactcagtgtcctcttcctgttgcatgtatgtggctccaaccgt
attccagaatccgggggagacaacagcgtgttcgacatctttgaactcacgggcgctgcc
cggaagggctctgggcgccggctggtgaaggggcctgactcttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gccgtgcgggcagagaaaggcttccttctcttggcctccctgaggcagatgaagaagacc
cgaggcacactgctggccatagaacggaaagaccactcgggccaggttttcagtgtggtc
tccaatggcaaggcgggcaccctggacctgagcctaaccgtgcaggggatgcagcatgtg
gtgtcggtggaagaagcgctcctggcgaccggccaatggaagagcatcaccctgtttgtg
caggaggacagggcccagctgtacatcgactgtgagaagatggagaacgccgagctggat
gtccccatccaaagcatcttcaccagggacctggccaacgttgccagactccgcatcgca
aaaggaggtgtcaatgacaatttccagggggtgctgcagaatgtgaggttcgtcttcgga
accacaccagaagccatcctcaggaacaaaggctgttcgagctctaccaacgttcttctc
accctcgacaacaacgtggtaaacggctccagccctgccatccggactaactacattggc
cacaagacaaaggatctgcaagccatctgtggcatttcgtgcgatgagctgtccagcatg
gtcctggagttgaggggcctgcgcaccatcgtgaccaccctccaggacagcatccgcaaa
gtgactgaagagaacaaggagttggccaatgagctaaggaggcctcccctctgctaccac
aacggagttcagtacaggaataacgaggaatggactgttgatagctgcacggagtgtcgc
tgtcagaactctgttaccatctgcaaaaaagtgtcctgccccatcatgccctgctccaat
gccacagttcccgatggagaatgctgcccacggtgttggcccagcgactctgcggatgat
ggctggtccccgtggtctgagtggacctcctgctctgtgacctgtggcaacggaatccag
cagcgcggtcgctcctgtgacagcctcaacaaccgctgcgagggctcctccgtccagact
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggcggctggagccac
tggtccccgtggtcgtcttgttctgtgacatgcggtgacggtgtgatcacaaggatccga
ctctgcaattcccctagcccccagatgaacgggaagccgtgtgaaggcgaagctcgagag
accaaggcctgcaggagagacgcgtgccccatcaatggaggctggggtccctggtcactg
tgggacatctgttctgtcacctgcggaggaggggtgcagacacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgcgacagaaaaccagatc
tgcaacaagcaggactgtccaattgacggatgcctgtccaatccctgctttgctggggtc
aagtgtaccagttaccctgacggcagctggaaatgtggtgcttgtccccccggctacagt
ggaaatggcatccaatgcaaagacatcgatgagtgcaaagaagtacctgacgcctgcttc
aaccacaacggggagcacaggtgtgagaacacggacccgggctacaactgtctgccctgc
cccccacgcttcactggcccgcagcccttcggccggggtgtggaatatgccaccgccaac
aaacaggtatgcaagccccgcaacccctgcacagatgggacacacgactgcaacaagaac
gccaagtgcagctacctgggccattacagtgaccccatgtaccgctgtgagtgcaagccc
ggctacgcaggcaatggcatcatctgcggtgaggacacggacctggacggctggcccaac
gaggacctggtgtgcgtggccaatgccacctaccactgcaaaaaggataattgccccaac
cttcccaactccgggcaggaagactatgacaaggatggaattggcgacgcctgtgatgac
gacgacgacaatgataaaatcccagatgacagggacaactgtccattccactataaccca
gcccagtatgactatgaccgggatgacgtgggagaccgctgtgacaactgcccctacaac
cacaacccagatcaggctgacacagacaacaacggggaaggagatgcctgcgccgctgac
atcgacggggatggtatcctcaatgaacgagacaactgccagtacgtctacaacgtggac
cagagggacacggatatggatggggtcggcgatcagtgtgacaactgccccctggaacac
aatccagatcagctcgactctgactcagaccgcatcggagacacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaacctggacaattgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaggacggcaagggagacgcctgcgaccatgatgatgacaac
gatggcattcctgatgatagggacaactgcagactcgtgcccaatcctgaccagaaggat
tctgacggtgacggtcgaggtgatgcttgcaaagatgattttgaccatgacaatgtgcca
gacattgatgacatctgtcccgaaaacattgatatcagtgagaccgatttccgccgattc
cagatgattcctctagatcccaaagggacgtcccaaaatgaccctaactgggtggtgcgc
catcagggtaaagaactcgtccagactgtcaactgcgatccaggacttgctgtaggttac
gatgagtttaacgcagtggacttcagtggcaccttcttcatcaacactgagagggatgat
gactatgctggatttgtgtttggctaccagtctagcagccgcttttatgtggtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccactagggctcagggatactcaggc
ctttctgtgaaagtggtgaactccacaacagggccaggcgagcacctacggaacgccctg
tggcacacgggaaacacccccggccaggtgcgcactctgtggcatgaccctcgtcacata
ggctggaaagatttcactgcctacaggtggcgtctcagccaccgaccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgattcaggacccatctacgac
aaaacctatgctggaggtagactggggttgtttgtcttctctcaagaaatggtgttcttc
tccgacctgaaatacgaatgcagagattcctaa

DBGET integrated database retrieval system