KEGG   Felis catus (domestic cat): 101092705Help
Entry
101092705         CDS       T02385                                 

Gene name
PDK1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
fca  Felis catus (domestic cat)
Pathway
HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    101092705 (PDK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     101092705 (PDK1)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   101092705 (PDK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 438 aa AA seqDB search
MRLARLLRGAASAGPGSGLRAASPGASRSFTSDSASGPAPESGVPGQVDFYARFSPSPLS
MKQFLDFGSMNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSL
QELLEFKDKSAEDAKTIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQ
YFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVVEVIKDGYENARR
LCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHADKGVY
PPVQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYG
LPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEAD
DWCVPSREPKDMTTFRSA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgcggctgcttcgcggagccgcctcggccggcccgggctccgggctgcgc
gcggccagccccggcgccagccgcagcttcacctcggactcggcctccgggccggcgccc
gaaagcggcgttccgggccaggtggacttctacgcgcgcttctcgccgtccccgctctct
atgaaacagttcctggacttcggatctatgaatgcttgtgaaaagacctcatttatgttt
ctgcggcaagagctgcctgttagattggcaaatataatgaaggaaattagtctacttcca
gataatcttctcaggactccatcagttcagttagtacaaagctggtatattcagagcctt
caggagcttcttgaatttaaagacaaaagtgctgaagatgctaaaactatttatgacttt
acagatactgtgattcggatcaggaaccgacacaatgatgttattcctacgatggcccag
ggagtgattgaatacaaggagagcttcggggtggaccccgtcaccagccagaatgttcag
tactttttggatcgcttctacatgagtcgcatttcaattagaatgttactcaatcagcac
tctttattgtttggtggaaaaggcaaaggaagcccgtctcatcgaaaacacattggaagc
ataaatccaaactgcaatgtagttgaagttattaaagatggctatgaaaatgctaggcgt
ctatgtgatttgtattatattaattctcctgaactagaacttgaagaactaaatgcaaaa
tcaccaggacagccaatacaagtggtttatgtaccatcccatctctatcacatggtgttt
gaacttttcaagaacgcgatgcgagcgacgatggagcaccatgctgacaaaggtgtttac
cctcctgttcaagtccacgtcacactgggtaacgaggatttgactgtgaagatgagtgac
cgaggaggtggtgttcctttgaggaaaattgacagactcttcaactacatgtactcaact
gcaccccggcctcgtgttgagacatctcgagcagtgcccctggctggttttggttatgga
ttgcccatatcacgtctttatgcccagtacttccaaggagacctaaagctatattctcta
gagggttatgggacagatgcagttatctacattaaggctctgtcaacagactcgatagaa
agactcccggtgtataacaaagctgcctggaagcactacaacaccaaccatgaggctgat
gactggtgcgtccctagcagagaaccaaaagacatgacaacatttcgcagtgcctag

DBGET integrated database retrieval system