KEGG   Felis catus (domestic cat): 101092925Help
Entry
101092925         CDS       T02385                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04072  Phospholipase D signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04750  Inflammatory mediator regulation of TRP channels
fca04919  Thyroid hormone signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
fca05231  Choline metabolism in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101092925 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101092925 (PLCG1)
   04015 Rap1 signaling pathway
    101092925 (PLCG1)
   04012 ErbB signaling pathway
    101092925 (PLCG1)
   04370 VEGF signaling pathway
    101092925 (PLCG1)
   04064 NF-kappa B signaling pathway
    101092925 (PLCG1)
   04066 HIF-1 signaling pathway
    101092925 (PLCG1)
   04020 Calcium signaling pathway
    101092925 (PLCG1)
   04070 Phosphatidylinositol signaling system
    101092925 (PLCG1)
   04072 Phospholipase D signaling pathway
    101092925 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    101092925 (PLCG1)
   04660 T cell receptor signaling pathway
    101092925 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    101092925 (PLCG1)
   04659 Th17 cell differentiation
    101092925 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    101092925 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    101092925 (PLCG1)
   04670 Leukocyte transendothelial migration
    101092925 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101092925 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    101092925 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101092925 (PLCG1)
  Development
   04360 Axon guidance
    101092925 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101092925 (PLCG1)
   05231 Choline metabolism in cancer
    101092925 (PLCG1)
   05206 MicroRNAs in cancer
    101092925 (PLCG1)
   05205 Proteoglycans in cancer
    101092925 (PLCG1)
   05225 Hepatocellular carcinoma
    101092925 (PLCG1)
   05214 Glioma
    101092925 (PLCG1)
   05223 Non-small cell lung cancer
    101092925 (PLCG1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101092925 (PLCG1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101092925 (PLCG1)
   05169 Epstein-Barr virus infection
    101092925 (PLCG1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    101092925 (PLCG1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101092925 (PLCG1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101092925 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101092925 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 101092925
NCBI-ProteinID: XP_023107018
Ensembl: ENSFCAG00000009032
Position
A3
AA seq 1291 aa AA seqDB search
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRTDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
VERPELCRVSLPEFQQFLLEYQGELWAIDQLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPETMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVVLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPYAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKAGYRAVPLKNNYSEDL
ELASLLIKIEVFPAKQENGDVSPFSSMSLRERGSDASGQLFHGRGREGSFEARYQQPFED
FRVSQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaatggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccggagcggaagaccttccaggtcaagctggagacgcggcagatc
acgtggagccgtggcgccgacaagatcgagggggccattgacattcgagaaatcaaggag
atccgcccagggaagacctcacgggattttgatcgctaccaagaggatcctgctttccga
acagaccagtcacactgctttgtcatactgtatgggatggagttccgcctgaagaccctg
agcctgcaagctacatctgaggatgaagtgaacatgtggatcaaggggttaacttggctg
atggaagatacattgcaggcggccacacctctgcagattgaaaggtggctgaggaagcag
ttctattcggtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcgtctgacggac
ctggagcagcgcagcagtgacatcacctatgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtgccctgagggcg
gtggagcggccggagctctgtcgcgtgtcccttcctgagttccagcagttcctcctcgag
taccagggggagctgtgggccatcgaccagcttcaggtgcaagaatttatgctcagcttt
ctccgagaccccttgcgagagattgaagagccgtacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaacagtgtgtggaactcacagctggatgcagtgtgcccagaa
accatgaacaaccccctctcccactactggatctcctcctcccacaacacatacctgacc
ggggaccagttctccagcgagtcctccctggaagcctacgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggatggcccagatgggatgccagtcatttaccat
ggacacacccttaccaccaagatcaagttctcagacgtcctgcacactatcaaggagcac
gcctttgtggcctcagagtacccggtcatcctgtccattgaggaccattgcagcattgcc
cagcagaggaacatggcacagtacttcaagaaggtgcttggggacacactccttaccaag
cctgtggacatcgctgccgatggactcccctcacccaaccagctcaagaggaagatcctt
atcaagcacaagaagctggcagagggcagtgcctatgaagaggtgcctacatcagtgatg
tactccgagaacgatatcagcaactccatcaagaatggcatcctctacctggaggaccct
gtgaaccacgagtggtatccccactacttcgtcctgaccagcagcaaaatctactactct
gaggagacgagcagtgaccagggcaacgaggatgaggaggagcccaaggaggccagtggc
agcacagagctgcactccagtgagaaatggttccacgggaagctcggggcaggacgggat
gggcggcacatcgctgagcgcctgcttaccgagtactgcattgagaccggggcccctgat
ggctccttcctcgtgcgagagagcgagaccttcgtgggcgactataccctctctttctgg
cggaatgggaaagtccagcactgccggatccactctcggcaggacgctggggcccccaag
ttcttcttgacagacaacctggtctttgactcgctctatgacctcatcacacactaccag
caggtgcccctacgctgcaacgaatttgagatgcgcctctcagagccagtcccgcagacc
aatgcccacgagagcaaagagtggtaccatgccagcctgaccagagctcaggccgagcac
atgctgatgcgcgtcccccgggatggggccttcctggtgaggaaacggaatgagcccaac
tcctacgccatctccttccgggctgagggcaagatcaagcattgccgcgtccagcaggag
ggccagacggtggtcctgggcaactcagagttcgacagcctcgtggacctcatcagctac
tacgagaagcacccactgtaccgcaagatgaagctgcgctatcccatcaacgaggaggcg
ctggagaagatcggcacagctgagccagactacggggccctgtatgagggccgcaaccca
ggcttctatgtggaggcgaatcctatgccgactttcaagtgtgcagtcaaagcactcttt
gactacaaggcccagagagaggatgagctgactttcactaagagcgccatcatccagaac
gtggagaagcaagaaggtggctggtggcggggggactatggtgggaagaagcagctgtgg
ttcccgtcaaactacgtggaagagatggtcagccccgcagccctggagcctgagagggag
cacttggacgagaacagccccttgggggatttgctccggggggtcttggatgtgccagct
tgtcagattgccatccgtcccgagggcaagaacaaccggctgttcgtcttctccatcagt
atggcttccgtggcgcactggtccctggatgtcgctgctgactcacaagaggagctgcag
gactgggtgaagaagatccgagaagtggcccagacggcagacgccaggctcacggagggc
aagatgatggagcggaggaagaagatcgccctggagctctccgagctggttgtctactgt
cgacctgttccctttgatgaagagaagattggcacagaacgtgcctgctaccgggacatg
tcgtccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttt
ctccagtacaaccggctgcagctctcccgcatctaccccaagggccagcggctggactct
tccaattacgaccccttgcccatgtggatctgtggcagtcagctcgtggctctcaacttc
cagaccccagacaagcctatgcagatgaaccaggccctcttcatggccggtggccactgt
ggctacgtgctgcagccgagcaccatgcgggatgaggcctttgatccctttgacaagagc
agcctccgaggcctggagccatatgccatctgcatcgaggtgctgggggcccggcacctg
ccgaagaatggccgaggcatcgtgtgtccttttgtggagattgaggtggccggagcagag
tatgacagcatcaaacagaagacagaatttgtggtggacaacggactgaaccctgtttgg
cccgccaagcccttccacttccagatcagtaacccagaattcgccttcctgcgctttgtg
gtgtatgaggaggacatgttcagtgaccagaacttcctggctcaggccaccttcccagta
aagggcttgaaggcaggatacagagccgtgcctttgaagaacaactacagtgaggacctg
gagctggcctccctgctcatcaagatcgaggttttccctgccaagcaggagaacggtgac
gtcagtcccttcagtagcatgtctctgcgcgagcggggctccgatgcctcgggtcagctg
ttccatggccggggccgggaaggttcctttgaagcccgctaccagcagccgtttgaggac
tttcgtgtctcccaagagcatctggcagaccattttgacagtcgggaacggagggcccca
cgaaggactcgggtcaacggggacaaccgcctctag

DBGET integrated database retrieval system