KEGG   Felis catus (domestic cat): 101092941Help
Entry
101092941         CDS       T02385                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101092941 (RASGRF1)
   04010 MAPK signaling pathway
    101092941 (RASGRF1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    101092941 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B3
AA seq 1311 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKRGRSEAEASKQGHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVATQLRRQIEDGEIEIERLKAEIAT
LLRDNERIQSTQTVTPNDEDSDIKKIKKSLLLMALVPSTPQIGSPRGPKADPGAVICGSP
DGTGTRLVALGGPQVPNPAAGAGWCLARRQVRRKTVVSVAMSQGPLPSSCQSGCAQRPNY
TPAKRGGLPGVPGSTAQSADTRRERLRVSISRSGVEPRELPLQQGDSETIMFLHQIFYQG
LKARISSWPTLVLGELFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAK
PDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDE
VSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLKK
EGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEDPESTEEEAKGSSQDIDHL
DFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQ
MIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVGRLLERLTDLRFLSIDFLNTFLHSYR
VFTTAVVVLDKLITIYRKPISAIPARSLELLFASGQNSKLLYGDPPKSPRATRKFSSPPP
LSIAKTSSPGRRRKLSLNIPIITGGKALDLAALSCNSNGYSSLYSAVSPFSKASLDTSKL
YVSSGFANKIPDEGDTAAEKPEEPSALSKQSSEVSVREESDNDEDQSEDGDTEASPTKSP
TTPKSVKSKNPSEFPLFSYNNGVVMTSCRELDNSRSALSAASAFAIATAGANEGAPSKDK
YRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNNELRGKVISF
LEEVMHDPELLTQERKAAVSPPRTLTQDDPGDNQVTLEEITQMAEGVKAEPFENHSALEI
AEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNED
INARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKL
QKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMIS
HIIREIRQFQQTAYKIEHQVKVTQYLLDQSFVMDEESLYESSLRMEPKLPT
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaacgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaaccttctcttctacttcgagagcgactcgagctcg
cggccctcggggctctacctgctggagggctgcgtctgcgaccgcgcgccctcccccaaa
agggggcgctcggaggctgaagcctcgaagcagggccattatttcacggtcaacttcagc
cacgagaaccagaaagccctggagctgaggacagaggacgccaaggattgtgacgagtgg
gtggcagccatcgctcatgccagctaccggaccctggccacggagcacgaagcgctgatg
cagaagtacctgcacctgctgcagattgtggagacggagaagacggtggccacgcagcta
cggcggcagatcgaggatggggagattgagatcgagcggctgaaggcagagatcgcgact
ctgctcagggacaacgagcgcatccagtccacccagactgtcacccccaacgatgaggac
agtgacatcaagaagattaagaagagccttctcctcatggctttggtccccagcacaccc
cagattggaagtccacggggccccaaagctgaccctggtgctgtgatctgtgggagccca
gatggcacggggacccgcctagtggctctgggcggtccccaggtccccaaccctgcggca
ggagccgggtggtgcctggcccggaggcaggtgcgtcggaaaacagtcgtctccgtggcc
atgagtcaaggtcctctcccaagctcttgccaaagtggctgcgcccagcggcccaactac
acgcccgccaagcgcggtggcttgccgggtgtcccgggcagcacggcacagtccgcggac
acgcgccgtgagcgcctgcgcgtctccatctcgaggtctggggtggagcccagggagctg
cctctccagcagggtgacagcgagaccatcatgttcctgcaccagattttctaccagggc
ctgaaggcccgcatctccagctggcccacgctggtcctgggtgagttgttcgacatcctg
ctgcccatgctgaacatctaccaggagttcgtgcggaaccaccagtatagcctgcagatc
ctggcgcactgcaaacagaaccgggacttcgacaagctgctgaagcactacgaggccaag
ccagactgcgaggagaggacgctggagaccttcctcacctaccccatgttccagattccc
aggtacatcctgacgctgcacgagctcctggcccacacccctcatgagcacgtggagcgg
aacagcctggactatgccaaatccaagctggaggagctgtccaggataatgcatgacgaa
gtgagtgagacagagaacatccggaaaaatctagccatcgagcgtatgattatcgaaggc
tgtgaaatcctgctggacaccagccagactttcgtgagacagggctccctcatccaggtg
cccatgtctgagaagggcaagatcaccaggggccgcctggggtctctgtccctgaagaaa
gagggcgagcgacagtgtttcctgttctccaagcatctcatcatctgcaccaggggctct
ggcgggaaactgcacctgaccaagaacggggtcatctccctcatcgactgcaccttgctg
gaggacccagagagcacggaagaagaagccaaagggtccagccaagacatagaccacttg
gattttaagatcggggtggagcccaaggattctccgcctttcacggtcatcctcgtggcc
tcgtccagacaggagaaggcggcgtggaccagtgacatcagccagtgtgtggacaacatc
cgctgcaacggcctcatgatgaacgcgtttgaggagaattccaaggtcaccgtgccgcag
atgatcaagtcggacgcctccctgtactgcgatgacgtggacatccgcttcagcaaaacc
atgaactcctgcaaagtgctgcagatccgctacgccagcgtgggccggctgctcgagagg
ctgacggacctgcgcttcctgagcatcgacttcctcaacaccttcctgcactcctaccgc
gtcttcaccaccgccgtcgtggtcctggacaagctcatcaccatctacagaaagcccatc
agcgccatccccgccaggtccctggagcttttgtttgccagcggccagaacagcaagctt
ctgtatggcgacccccccaagtccccgcgcgccacgcgcaagttctcctcgccgcccccc
ctgtccatcgccaagacgtcgtcgcccggccgccggcggaagctgtccctgaacatcccc
atcatcacgggtggcaaggccctggacctggccgccctcagctgcaactccaatggctac
agcagcctgtactcggccgtgtcgcccttcagcaaggcctcgctggacaccagcaagctc
tacgtgtccagcggcttcgccaacaagattccggacgaaggtgacacggcagctgagaag
cccgaagagccctcggctctcagcaagcagagctcagaagtctccgtgagggaagagtcg
gataacgacgaggaccagagtgaggacggggacacggaggcgtcgccgaccaaatcccca
acgacgccaaagtcggtcaaaagcaaaaatccctcagagttccccctcttttcctacaac
aacggggtggtcatgacctcgtgtcgggaactggacaacagccgcagtgccctgtccgcg
gcctctgcctttgccatagcaacggcgggagccaacgagggcgccccaagcaaggacaag
taccgcaggatgtccctggccagcgcagggtttccccctgaccagcggaacggagacaag
gagtttgtgatccgcagagcggccaccaaccgggtcctgaacgtgctccgccactgggtc
tccaaacactctcaggactttgagaccaacaatgagctcagaggcaaggtgatcagcttc
ctggaggaggtcatgcacgaccccgagctcctgacccaggagaggaaggccgctgtctcg
ccccctaggactctgacccaggacgacccgggtgacaaccaggtcacgctggaggagatc
acacagatggcagaaggcgtgaaggcagagccctttgaaaaccactcagccctggagatc
gccgagcagctgaccttgctggaccacctcgtcttcaagaagatcccttacgaggagttc
ttcggacaaggctggatgaaactggagaagaatgagcggaccccttatatcatgaaaacc
acgaagcatttcaacgacatcagtaacttgattgcttcagagatcatccgcaacgaggac
atcaacgcgagagtgagcgccatcgagaagtgggtggccgtggccgacatatgccgctgt
ctgcacaactacaacgccgtcctggagatcacctcgtccatgaaccgcagcgcaatattc
cggctgaaaaagacgtggctcaaagtctccaagcagacaaaagctttgattgacaagctc
caaaagcttgtgtcatcagagggcagatttaagaatctcagagaagctctgaaaaattgt
gacccgccctgtgtcccttacctggggatgtacctcaccgacctggcctttatcgaagag
gggacacccaattacacggaggacggcctggtcaacttctccaagatgaggatgatctct
cacatcatccgagagattcgccagttccagcaaactgcctataaaatagaacaccaggtg
aaggtgacccagtacctgctggaccagtccttcgtcatggatgaggagagcctctacgag
tcttccctgcgaatggagcccaaactccccacctga

DBGET integrated database retrieval system