KEGG   Felis catus (domestic cat): 101092944Help
Entry
101092944         CDS       T02385                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    101092944 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    101092944 (ARG2)
   00330 Arginine and proline metabolism
    101092944 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    101092944 (ARG2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101092944 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B3
AA seq 354 aa AA seqDB search
MSLRSSLSRLLRTRVHSVLKKSVHSVAVIGAPFSQGQKRKGVERGPAAIREAGLMKRLSS
LGCRLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYITEEIHNTGLLSALDLVEVNPQ
LAASEEEAKATAGLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESESEERVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgagaagcagcctctcgcgtctcctccggacgcgagtgcattccgtcctgaag
aagtcggttcactcggtggctgtgatcggagccccgttctcacagggacagaaaagaaaa
ggagtggaacgtggtcctgctgccatccgagaagctggcttgatgaaaagactctccagt
ttaggctgccgcctgaaagattttggagatttgagttttactccagtccctaaagatgat
ctctacaacaacctgattgtgaatcctcgctcagtgggccttgccaaccaggaattggct
gaggtggttagtagagctgtgtcaggtggctacagctgtgtcacagtgggaggagatcac
agcctggcaattggtaccattagtggccacgcccgacattgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtaccacaactcccagga
ttttcttggatcaaaccttgtatctcttccccaagtatcgtgtatattggtctgagagat
gtggaccctcctgaacattttattttaaagaattatgatatccagtatttttccatgaga
gacatagatcgacttggtatccagaaggttatggaacagacatttgatctgctaattggc
aaaagacaaaggccaatccatctgagttttgatattgatgcatttgaccctacactggct
ccagccacaggaacccctgttgtaggaggactgacctatcgagaaggcatgtatattact
gaagaaatacacaatacaggattgctgtcagcactggatcttgttgaagtcaaccctcag
ctggctgcttcagaggaagaggccaaggctactgcaggcctggcagtggatgtgattgct
tccagttttggtcagacaagggagggagggcacattgtctatgaccaacttcctactccc
agttcaccagatgaatcagaaagtgaagaacgtgtgagaatttag

DBGET integrated database retrieval system