KEGG   Felis catus (domestic cat): 101092977Help
Entry
101092977         CDS       T02385                                 

Gene name
PLA2G15
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:fca00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:fca04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E2
AA seq 408 aa AA seqDB search
MGLRLCPYSAALLLGGLLFLLLLVDPALPVGRPPPVVLVPGDLGNQLEAKLDKPTVVHYL
CSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSL
EFLDPSRSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEM
HQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIRAFVALGAPWGGVAKTLRVLASGD
NNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVRTPTANYTLRDYRQFFQDIGF
KDGWLMRQDTEGLVEATVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVN
LQSALQCQAWRSRQEHQVSLHALPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttcgcctctgtccctactctgcggcgctgctcctgggtggcctcctgttcctc
ctgctgctcgtagacccggcgctcccagtcggacgtccccctcctgtggtgctggtgcct
ggtgatttgggcaaccagctggaggcaaagctggacaagccaacggtcgtacactacctc
tgctccaagaggacggacagctacttcaccctctggctgaacctcgagctgctgctacct
gtcatcattgactgctggatcgacaacatcaggctggtttacaacagaacatcccgggcc
acgcagtttccagatggtgtagatgtgcgtgttcctggctttggggagactttctcactg
gagttcctggaccccagcagaagcagtgtgggttcctatttccataccatggtagagagt
cttgtgggctggggctacacacggggtgaggatgtccggggggccccctacgactggcgc
cgagccccaaatgaaaacgggccctacttcctggctctccgggagatgatcgaggagatg
catcagctgtatgggggccctgtggtgctggttgcccacagcatgggcaacatgtacaca
ctctactttctgcagcggcagccacaggcctggaagaacaagtatatccgtgcctttgtg
gcactgggtgcgccctgggggggcgtggccaagactttgcgtgtcctggcctcaggagac
aacaatcggatcccggtcattgggcccctgaagattcgggagcagcagcggtctgccgtc
tccaccagctggctgctgccctacaactatacctggtcccctgagaagatcttcgtgcgt
acacccacagccaactacacgctgcgggactaccgccagttcttccaggacattggcttc
aaagatggatggctcatgcggcaggacacggaggggctggtcgaagccacagtgccccct
ggcgtgccgctgcactgcctctatggcactggtgtccccacgccagactccttctactat
gagagcttcccagaccgtgatcccaaaatctgctttggtgatggcgacggcactgtgaac
ttgcagagcgccctgcagtgccaggcctggcgcagccgccaggagcaccaagtgtcactg
cacgcgctcccgggcagcgagcacatcgagatgctggccaacgccactaccctcgcctat
ctgaaacgtgtgcttcttgggccctga

DBGET integrated database retrieval system