KEGG   Felis catus (domestic cat): 101092977Help
Entry
101092977         CDS       T02385                                 

Gene name
PLA2G15
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101092977 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101092977 (PLA2G15)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101092977 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
E2
AA seq 408 aa AA seqDB search
MGLRLCPYSAALLLGGLLFLLLLVDPALPVGRPPPVVLVPGDLGNQLEAKLDKPTVVHYL
CSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSL
EFLDPSRSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEM
HQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIRAFVALGAPWGGVAKTLRVLASGD
NNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVRTPTANYTLRDYRQFFQDIGF
KDGWLMRQDTEGLVEATVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVN
LQSALQCQAWRSRQEHQVSLHALPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttcgcctctgtccctactctgcggcgctgctcctgggtggcctcctgttcctc
ctgctgctcgtagacccggcgctcccagtcggacgtccccctcctgtggtgctggtgcct
ggtgatttgggcaaccagctggaggcaaagctggacaagccaacggtcgtacactacctc
tgctccaagaggacggacagctacttcaccctctggctgaacctcgagctgctgctacct
gtcatcattgactgctggatcgacaacatcaggctggtttacaacagaacatcccgggcc
acgcagtttccagatggtgtagatgtgcgtgttcctggctttggggagactttctcactg
gagttcctggaccccagcagaagcagtgtgggttcctatttccataccatggtagagagt
cttgtgggctggggctacacacggggtgaggatgtccggggggccccctacgactggcgc
cgagccccaaatgaaaacgggccctacttcctggctctccgggagatgatcgaggagatg
catcagctgtatgggggccctgtggtgctggttgcccacagcatgggcaacatgtacaca
ctctactttctgcagcggcagccacaggcctggaagaacaagtatatccgtgcctttgtg
gcactgggtgcgccctgggggggcgtggccaagactttgcgtgtcctggcctcaggagac
aacaatcggatcccggtcattgggcccctgaagattcgggagcagcagcggtctgccgtc
tccaccagctggctgctgccctacaactatacctggtcccctgagaagatcttcgtgcgt
acacccacagccaactacacgctgcgggactaccgccagttcttccaggacattggcttc
aaagatggatggctcatgcggcaggacacggaggggctggtcgaagccacagtgccccct
ggcgtgccgctgcactgcctctatggcactggtgtccccacgccagactccttctactat
gagagcttcccagaccgtgatcccaaaatctgctttggtgatggcgacggcactgtgaac
ttgcagagcgccctgcagtgccaggcctggcgcagccgccaggagcaccaagtgtcactg
cacgcgctcccgggcagcgagcacatcgagatgctggccaacgccactaccctcgcctat
ctgaaacgtgtgcttcttgggccctga

DBGET integrated database retrieval system