KEGG   Felis catus (domestic cat): 101093104Help
Entry
101093104         CDS       T02385                                 

Gene name
MRPS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
fca  Felis catus (domestic cat)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101093104 (MRPS18B)
Ribosome [BR:fca03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    101093104 (MRPS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B2
AA seq 258 aa AA seqDB search
MAASLSCSLLRRLLNLSPFRGAYGVQVPLQTLCTKALPEEDSLPLDPITPYKNEPWKYLD
SEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKTCIRRDKVAGNPCPICRDPKLHVDFRNL
KLLEQFVCAHTGVIFHAPYTGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTS
HGAVSATLPAPSLVSGDPWYPWYSWKQPPERELSRLRRLYQSHLREESGPPPESMPELPL
TTPAEASSTEQESPQSAL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccctatcgtgttcgttgctgaggcgccttcttaacctttcgcccttcaga
ggtgcctacggagttcaggttcccctccagactctttgcaccaaagcccttcctgaggaa
gattctttgcccctagatcccataaccccttataagaatgaaccctggaaatatctggac
tccgaagaataccagaatcgctatggttctcgccctgtgtgggctgactaccgtcgaaac
cacaaaggtggcataccccctcagcgaactcgaaagacctgtattcgtagagacaaagtt
gctgggaatccctgccccatctgccgggatcccaagctgcatgttgactttaggaacctg
aagctcttggaacaatttgtctgcgcccacacgggtgtcatctttcatgctccgtacaca
ggggtctgtatgaagcaacacaagaagttgacccaagccatccagaaagccagggatcat
ggtctcctcaggtaccacattcctcaggttgaacctcgggaccttgacttcagtacctct
catggagctgtgagtgctactctaccagcacccagcctggtgtcaggtgacccctggtac
ccatggtacagctggaaacagccaccagagagagagctgtcccgtcttcgacgcctctat
cagagtcatctccgagaagagagtggtcccccaccagagtcaatgcccgaattgccactc
acaaccccagctgaagcctcctccactgagcaggagagcccccagagtgctctgtag

DBGET integrated database retrieval system